BLASTX nr result
ID: Scutellaria22_contig00014638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00014638 (586 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514941.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 emb|CAN80085.1| hypothetical protein VITISV_011295 [Vitis vinifera] 61 1e-07 ref|XP_002311719.1| predicted protein [Populus trichocarpa] gi|2... 58 1e-06 >ref|XP_002514941.1| conserved hypothetical protein [Ricinus communis] gi|223545992|gb|EEF47495.1| conserved hypothetical protein [Ricinus communis] Length = 156 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +1 Query: 424 MEEDGMRARSFRYEDYNTRRVFLRSYPLHW-GTESEAEESVEPAT 555 ME +GMR RSFRYEDYN RRVFLRSYPL W G + +A E + T Sbjct: 1 MEANGMRTRSFRYEDYNNRRVFLRSYPLQWEGEDQKANEEMGKVT 45 >emb|CAN80085.1| hypothetical protein VITISV_011295 [Vitis vinifera] Length = 112 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/54 (55%), Positives = 33/54 (61%) Frame = +1 Query: 424 MEEDGMRARSFRYEDYNTRRVFLRSYPLHWGTESEAEESVEPATTATTKCGKEE 585 ME++GMRARSFR EDYN RRVFLRSYPL WG E + GK E Sbjct: 1 MEDNGMRARSFRNEDYNNRRVFLRSYPLDWGENDEENKDKGKKDEENKDKGKTE 54 >ref|XP_002311719.1| predicted protein [Populus trichocarpa] gi|224159625|ref|XP_002338101.1| predicted protein [Populus trichocarpa] gi|222851539|gb|EEE89086.1| predicted protein [Populus trichocarpa] gi|222870908|gb|EEF08039.1| predicted protein [Populus trichocarpa] Length = 145 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/53 (54%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Frame = +1 Query: 418 KGMEEDGMRARSFRYEDYNTRRVFLRSYPLHWGTESEA--EESVEPATTATTK 570 K MEE+G + RS R++DY RRVFLRSYPLH+G E E EE V T K Sbjct: 4 KDMEENGTKTRSLRFQDYYNRRVFLRSYPLHFGAEDEKTNEEKVSATNKDTEK 56