BLASTX 2.2.25 [Feb-01-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Scutellaria22_contig00014606
         (217 letters)

Database: ./nr 
           23,641,837 sequences; 8,123,359,852 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

dbj|BAC53934.1| hypothetical protein [Nicotiana tabacum]               59   4e-07

>dbj|BAC53934.1| hypothetical protein [Nicotiana tabacum]
          Length = 256

 Score = 58.9 bits (141), Expect = 4e-07
 Identities = 33/71 (46%), Positives = 36/71 (50%)
 Frame = +3

Query: 3   PPVATAVLKLSLHCDGCIDKIYKTVTKTEGRFDQNP*QNYLHHC*IKSLIHSTAIPGYKE 182
           PP+ TAVLK+ LHC GCI KIYK VTK                             GYKE
Sbjct: 69  PPITTAVLKVHLHCQGCIQKIYKIVTK---------------------------FKGYKE 101

Query: 183 MKIETQKDLVT 215
           MKI+ QKDLVT
Sbjct: 102 MKIDKQKDLVT 112