BLASTX nr result
ID: Scutellaria22_contig00014260
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00014260 (517 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004154554.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease... 80 1e-13 ref|XP_004139931.1| PREDICTED: 26S protease regulatory subunit 6... 80 1e-13 sp|P54778.1|PRS6B_SOLTU RecName: Full=26S protease regulatory su... 80 1e-13 gb|AFK43608.1| unknown [Medicago truncatula] 80 1e-13 ref|XP_002276130.2| PREDICTED: 26S protease regulatory subunit 6... 80 1e-13 >ref|XP_004154554.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 6B homolog [Cucumis sativus] Length = 418 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 3 EAGMHAVRKNRYVILPKDFNKGYRSNVKKPDTDFEFYK 116 EAGMHAVRKNRYVILPKDF KGYR+NVKKPDTDFEFYK Sbjct: 381 EAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 418 >ref|XP_004139931.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Cucumis sativus] Length = 418 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 3 EAGMHAVRKNRYVILPKDFNKGYRSNVKKPDTDFEFYK 116 EAGMHAVRKNRYVILPKDF KGYR+NVKKPDTDFEFYK Sbjct: 381 EAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 418 >sp|P54778.1|PRS6B_SOLTU RecName: Full=26S protease regulatory subunit 6B homolog gi|1155334|gb|AAB67835.1| POTATP1 [Solanum tuberosum] Length = 413 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 3 EAGMHAVRKNRYVILPKDFNKGYRSNVKKPDTDFEFYK 116 EAGMHAVRKNRYVILPKDF KGYR+NVKKPDTDFEFYK Sbjct: 376 EAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 413 >gb|AFK43608.1| unknown [Medicago truncatula] Length = 415 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 3 EAGMHAVRKNRYVILPKDFNKGYRSNVKKPDTDFEFYK 116 EAGMHAVRKNRYVILPKDF KGYR+NVKKPDTDFEFYK Sbjct: 378 EAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 415 >ref|XP_002276130.2| PREDICTED: 26S protease regulatory subunit 6B homolog [Vitis vinifera] Length = 418 Score = 80.5 bits (197), Expect = 1e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +3 Query: 3 EAGMHAVRKNRYVILPKDFNKGYRSNVKKPDTDFEFYK 116 EAGMHAVRKNRYVILPKDF KGYR+NVKKPDTDFEFYK Sbjct: 381 EAGMHAVRKNRYVILPKDFEKGYRTNVKKPDTDFEFYK 418