BLASTX nr result
ID: Scutellaria22_contig00013429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00013429 (449 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003561251.1| PREDICTED: spermidine synthase 1-like [Brach... 62 4e-08 gb|AFF18802.1| spermidine synthase, partial [Dimocarpus longan] 62 6e-08 ref|XP_002888767.1| hypothetical protein ARALYDRAFT_476155 [Arab... 62 6e-08 emb|CAO02391.1| spermidine synthase [Cochlearia officinalis] 62 6e-08 sp|O82147.1|SPDE_COFAR RecName: Full=Spermidine synthase; Short=... 61 8e-08 >ref|XP_003561251.1| PREDICTED: spermidine synthase 1-like [Brachypodium distachyon] Length = 382 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = +1 Query: 4 KTKGPLKFYNSEIHSAAFCLPSFARKVIDSKSD 102 K+KGPLKFYNSEIHSA+FCLPSFA++VI+SKS+ Sbjct: 350 KSKGPLKFYNSEIHSASFCLPSFAKRVIESKSN 382 >gb|AFF18802.1| spermidine synthase, partial [Dimocarpus longan] Length = 165 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = +1 Query: 4 KTKGPLKFYNSEIHSAAFCLPSFARKVIDSK 96 K++GPLKFYNSEIHSAAFCLP+FA+KV+DSK Sbjct: 135 KSRGPLKFYNSEIHSAAFCLPTFAKKVVDSK 165 >ref|XP_002888767.1| hypothetical protein ARALYDRAFT_476155 [Arabidopsis lyrata subsp. lyrata] gi|297334608|gb|EFH65026.1| hypothetical protein ARALYDRAFT_476155 [Arabidopsis lyrata subsp. lyrata] Length = 340 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +1 Query: 4 KTKGPLKFYNSEIHSAAFCLPSFARKVIDSKSD 102 K+ GPLKFYN+EIHSAAFCLPSFA+KVIDSK++ Sbjct: 308 KSHGPLKFYNAEIHSAAFCLPSFAKKVIDSKAN 340 >emb|CAO02391.1| spermidine synthase [Cochlearia officinalis] Length = 328 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = +1 Query: 4 KTKGPLKFYNSEIHSAAFCLPSFARKVIDSKSD 102 K+ GPLKFYN+EIHSAAFCLPSFA+KVI+SKS+ Sbjct: 296 KSNGPLKFYNAEIHSAAFCLPSFAKKVIESKSN 328 >sp|O82147.1|SPDE_COFAR RecName: Full=Spermidine synthase; Short=SPDSY; AltName: Full=Putrescine aminopropyltransferase gi|3242659|dbj|BAA29033.1| spermidine synthase [Coffea arabica] Length = 316 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 4 KTKGPLKFYNSEIHSAAFCLPSFARKVIDSKSD 102 KT PLKFYNSEIHSAAFCLPSFA+KVIDSK++ Sbjct: 284 KTMKPLKFYNSEIHSAAFCLPSFAKKVIDSKAN 316