BLASTX nr result
ID: Scutellaria22_contig00013282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00013282 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003592610.1| Serine/threonine protein kinase family prote... 44 8e-06 >ref|XP_003592610.1| Serine/threonine protein kinase family protein [Medicago truncatula] gi|355481658|gb|AES62861.1| Serine/threonine protein kinase family protein [Medicago truncatula] Length = 646 Score = 43.9 bits (102), Expect(2) = 8e-06 Identities = 28/61 (45%), Positives = 39/61 (63%), Gaps = 8/61 (13%) Frame = +1 Query: 1 FRCLQVEKELRPSMDEVVSFLKEIQSG-GGIEFEMKKEGNG-NVLHS------VSPETDD 156 F+CLQ +KELRPSM+EV+ L+ I+SG G+E + + +G HS VSPE D+ Sbjct: 553 FQCLQKDKELRPSMEEVLDELRRIESGKDGVEVVEEADVDGVGSSHSIIQPPPVSPEWDE 612 Query: 157 V 159 V Sbjct: 613 V 613 Score = 30.4 bits (67), Expect(2) = 8e-06 Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 3/29 (10%) Frame = +2 Query: 230 SPETDDVILLKN---KNFKSSPNAVIDRW 307 SPE D+V LLKN SSPN V D+W Sbjct: 607 SPEWDEVGLLKNVKIMKHPSSPNTVTDKW 635