BLASTX nr result
ID: Scutellaria22_contig00013255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00013255 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538839.1| PREDICTED: elongation of fatty acids protein... 98 6e-19 ref|XP_002310199.1| predicted protein [Populus trichocarpa] gi|2... 97 2e-18 ref|XP_002533270.1| conserved hypothetical protein [Ricinus comm... 96 3e-18 ref|XP_004157860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 94 1e-17 ref|XP_004141955.1| PREDICTED: uncharacterized protein LOC101205... 94 1e-17 >ref|XP_003538839.1| PREDICTED: elongation of fatty acids protein A-like [Glycine max] Length = 323 Score = 98.2 bits (243), Expect = 6e-19 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +2 Query: 5 CNLVCHVGVLLLHYIKGGCNGIGAWVFNSVLNGAILFLFLNFYLKMYLRRR 157 CNLVCHV VLLLH++ GGCNGIGAWVFNSVLNGAIL LFLNFY++MYL RR Sbjct: 235 CNLVCHVAVLLLHFLTGGCNGIGAWVFNSVLNGAILLLFLNFYVRMYLARR 285 >ref|XP_002310199.1| predicted protein [Populus trichocarpa] gi|222853102|gb|EEE90649.1| predicted protein [Populus trichocarpa] Length = 279 Score = 96.7 bits (239), Expect = 2e-18 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = +2 Query: 5 CNLVCHVGVLLLHYIKGGCNGIGAWVFNSVLNGAILFLFLNFYLKMYLRRR 157 CN+ CHVGVL LH++KGGCNGIGAW FNSVLNGAILFLFLNFY+KMYL +R Sbjct: 221 CNVACHVGVLSLHFMKGGCNGIGAWWFNSVLNGAILFLFLNFYVKMYLGKR 271 >ref|XP_002533270.1| conserved hypothetical protein [Ricinus communis] gi|223526895|gb|EEF29102.1| conserved hypothetical protein [Ricinus communis] Length = 295 Score = 95.9 bits (237), Expect = 3e-18 Identities = 41/51 (80%), Positives = 47/51 (92%) Frame = +2 Query: 5 CNLVCHVGVLLLHYIKGGCNGIGAWVFNSVLNGAILFLFLNFYLKMYLRRR 157 CNL CHVGVLLLH +KGGCNGIGAW+FNSVLNGAIL LFLNFY+KM+L ++ Sbjct: 227 CNLACHVGVLLLHLMKGGCNGIGAWIFNSVLNGAILLLFLNFYVKMHLAKK 277 >ref|XP_004157860.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229590 [Cucumis sativus] Length = 316 Score = 94.0 bits (232), Expect = 1e-17 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = +2 Query: 5 CNLVCHVGVLLLHYIKGGCNGIGAWVFNSVLNGAILFLFLNFYLKMYL 148 CNL CHVGVLLLH++KGGCNGIGAW FNSVLNGAIL LFLNFYLK++L Sbjct: 226 CNLACHVGVLLLHFMKGGCNGIGAWSFNSVLNGAILLLFLNFYLKIHL 273 >ref|XP_004141955.1| PREDICTED: uncharacterized protein LOC101205262 [Cucumis sativus] Length = 316 Score = 94.0 bits (232), Expect = 1e-17 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = +2 Query: 5 CNLVCHVGVLLLHYIKGGCNGIGAWVFNSVLNGAILFLFLNFYLKMYL 148 CNL CHVGVLLLH++KGGCNGIGAW FNSVLNGAIL LFLNFYLK++L Sbjct: 226 CNLACHVGVLLLHFMKGGCNGIGAWSFNSVLNGAILLLFLNFYLKIHL 273