BLASTX nr result
ID: Scutellaria22_contig00013119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00013119 (437 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533352.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 >ref|XP_002533352.1| conserved hypothetical protein [Ricinus communis] gi|223526817|gb|EEF29037.1| conserved hypothetical protein [Ricinus communis] Length = 112 Score = 59.3 bits (142), Expect = 3e-07 Identities = 40/111 (36%), Positives = 56/111 (50%), Gaps = 27/111 (24%) Frame = +3 Query: 123 MEGLIPVVYKSFKKNRIRRKYEPLSSGI------EEFYRKDDD----DPPASLRGAHHLR 272 MEGL+P+VYK+ K+NR RR+YE LSSG +FY D + P + + ++ Sbjct: 1 MEGLLPLVYKAIKRNRTRRQYECLSSGAAFAYNPADFYISDAETTYTKPSSIIMEKNNAG 60 Query: 273 CNSDR--RRSLDDIEDCKT---------------RQLVRFRSHRILSCITG 374 + RRS +ED +QLVRFRS R+ SC+TG Sbjct: 61 TGRSKLHRRSYSSVEDLSVTGSSRRRTAGASPPRKQLVRFRSQRMFSCVTG 111