BLASTX nr result
ID: Scutellaria22_contig00010472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00010472 (931 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002866832.1| hypothetical protein ARALYDRAFT_912374 [Arab... 57 8e-06 >ref|XP_002866832.1| hypothetical protein ARALYDRAFT_912374 [Arabidopsis lyrata subsp. lyrata] gi|297312668|gb|EFH43091.1| hypothetical protein ARALYDRAFT_912374 [Arabidopsis lyrata subsp. lyrata] Length = 614 Score = 56.6 bits (135), Expect = 8e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +1 Query: 832 PKKLLQLTTIDQYMSYHVKEIERTFAIKFPACT 930 P KL+Q+TT+D+Y+ YHVKE ER+F IKFPACT Sbjct: 182 PNKLMQVTTLDRYIRYHVKEFERSFMIKFPACT 214