BLASTX nr result
ID: Scutellaria22_contig00010303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00010303 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521240.1| WD-repeat protein, putative [Ricinus communi... 57 2e-06 >ref|XP_002521240.1| WD-repeat protein, putative [Ricinus communis] gi|223539508|gb|EEF41096.1| WD-repeat protein, putative [Ricinus communis] Length = 482 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/53 (54%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Frame = -2 Query: 395 KPRSRGWMHHMVSAEDLMLQLFSLS--RRSESSGEHSDAATRDLVQLLLTFDA 243 KP++RGWM+ + S +DLMLQLFSL R S E S AA R+L++L+LTF+A Sbjct: 412 KPKARGWMYRIASPQDLMLQLFSLQRWRTSPERIEESSAAGRELLELMLTFNA 464