BLASTX nr result
ID: Scutellaria22_contig00010233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00010233 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20340.3| unnamed protein product [Vitis vinifera] 58 7e-07 ref|XP_002282052.1| PREDICTED: WD repeat-containing protein 44-l... 58 7e-07 ref|XP_004141232.1| PREDICTED: WD repeat-containing protein 44-l... 57 2e-06 ref|XP_003539589.1| PREDICTED: WD repeat-containing protein 44-l... 57 2e-06 ref|XP_002534244.1| WD-repeat protein, putative [Ricinus communi... 57 2e-06 >emb|CBI20340.3| unnamed protein product [Vitis vinifera] Length = 749 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 209 NKSAWGMVIVTAGLRGEIRTFQNFGLPFQI 120 N SAWGMVIVTAGLRGEIRTFQNFGLP +I Sbjct: 720 NGSAWGMVIVTAGLRGEIRTFQNFGLPVRI 749 >ref|XP_002282052.1| PREDICTED: WD repeat-containing protein 44-like [Vitis vinifera] Length = 880 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 209 NKSAWGMVIVTAGLRGEIRTFQNFGLPFQI 120 N SAWGMVIVTAGLRGEIRTFQNFGLP +I Sbjct: 851 NGSAWGMVIVTAGLRGEIRTFQNFGLPVRI 880 >ref|XP_004141232.1| PREDICTED: WD repeat-containing protein 44-like [Cucumis sativus] gi|449498657|ref|XP_004160597.1| PREDICTED: WD repeat-containing protein 44-like [Cucumis sativus] Length = 918 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 212 QNKSAWGMVIVTAGLRGEIRTFQNFGLPFQI 120 Q SAWGMVIVTAGLRGEIRTFQNFG P +I Sbjct: 888 QGSSAWGMVIVTAGLRGEIRTFQNFGFPVKI 918 >ref|XP_003539589.1| PREDICTED: WD repeat-containing protein 44-like [Glycine max] Length = 766 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 203 SAWGMVIVTAGLRGEIRTFQNFGLPFQI 120 SAWGMVIVTAGLRGEIRTFQNFGLP +I Sbjct: 739 SAWGMVIVTAGLRGEIRTFQNFGLPLRI 766 >ref|XP_002534244.1| WD-repeat protein, putative [Ricinus communis] gi|223525645|gb|EEF28134.1| WD-repeat protein, putative [Ricinus communis] Length = 944 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 212 QNKSAWGMVIVTAGLRGEIRTFQNFGLPFQI 120 QN SA+GMVIVTAGLRGEIRTFQNFGLP +I Sbjct: 914 QNMSAYGMVIVTAGLRGEIRTFQNFGLPVRI 944