BLASTX nr result
ID: Scutellaria22_contig00010010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00010010 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513901.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 >ref|XP_002513901.1| conserved hypothetical protein [Ricinus communis] gi|223546987|gb|EEF48484.1| conserved hypothetical protein [Ricinus communis] Length = 380 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/65 (40%), Positives = 45/65 (69%) Frame = +1 Query: 4 NISSIVTNPSAIGCSIEKRLKPRLQILGILESEKLIQKWPALGTICRMPDHKFFLKFIEP 183 +IS IV +P + CS+ +RLKPRL +L +LE++KL+QK P+ + ++ +F K++ P Sbjct: 306 DISYIVRHPDLLICSVNQRLKPRLAVLQVLENKKLLQKKPSFTSFFKISGSQFLHKYVIP 365 Query: 184 YPNEV 198 Y +E+ Sbjct: 366 YSDEL 370