BLASTX nr result
ID: Scutellaria22_contig00006393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00006393 (457 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525675.1| conserved hypothetical protein [Ricinus comm... 62 5e-08 >ref|XP_002525675.1| conserved hypothetical protein [Ricinus communis] gi|223534975|gb|EEF36658.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 62.0 bits (149), Expect = 5e-08 Identities = 41/92 (44%), Positives = 51/92 (55%), Gaps = 15/92 (16%) Frame = +2 Query: 35 MREKAAVIFLYMLFFALFSSLPSTIAVPPSRSLKSVYDEIKSNPN--LYHE--------- 181 M ++ A + L +LFF FS L S++AVP +RSLKS D S+ L H+ Sbjct: 1 MVQRTAAVGL-LLFFLGFSFLLSSLAVPTTRSLKSTEDNPSSSVQDFLIHQEGMDLSSQG 59 Query: 182 ----FKKNERMDIEVADYSGTGANNHHDPGTP 265 F RMD+E DY GTGANNHHDP TP Sbjct: 60 EELDFIIAGRMDLESTDYPGTGANNHHDPKTP 91