BLASTX nr result
ID: Scutellaria22_contig00006373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00006373 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD15107.1| hypothetical protein [Nicotiana tabacum] 59 5e-07 >dbj|BAD15107.1| hypothetical protein [Nicotiana tabacum] Length = 364 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/63 (44%), Positives = 45/63 (71%), Gaps = 5/63 (7%) Frame = -3 Query: 214 SENLQTLSRLSPESCSKDVFAKASKLKRLGIRGRLEIAFKE-----PCIDKLFHLEKLKL 50 +++LQTLS ++PESC+++VFA+ LK+LGIRG++ + + + KL +LE LKL Sbjct: 201 NQSLQTLSTIAPESCTEEVFARTPNLKKLGIRGKIAVLLEPNKSLLKNVKKLEYLENLKL 260 Query: 49 VND 41 +ND Sbjct: 261 IND 263