BLASTX nr result
ID: Scutellaria22_contig00004182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00004182 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004171616.1| PREDICTED: 40S ribosomal protein S21-2-like ... 65 4e-09 ref|XP_004134210.1| PREDICTED: 40S ribosomal protein S21-2-like ... 65 4e-09 ref|XP_002512424.1| 40S ribosomal protein S21e, putative [Ricinu... 65 8e-09 ref|XP_003546356.1| PREDICTED: 40S ribosomal protein S21-like [G... 64 1e-08 ref|XP_003533393.1| PREDICTED: 40S ribosomal protein S21 [Glycin... 64 1e-08 >ref|XP_004171616.1| PREDICTED: 40S ribosomal protein S21-2-like isoform 2 [Cucumis sativus] Length = 82 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 224 TFALCGFIRAQGDADGALDRLWQKKKVETRQQ 129 TFALCGFIRAQGDAD ALDRLWQKKKVE RQQ Sbjct: 51 TFALCGFIRAQGDADSALDRLWQKKKVEVRQQ 82 >ref|XP_004134210.1| PREDICTED: 40S ribosomal protein S21-2-like isoform 2 [Cucumis sativus] gi|449432850|ref|XP_004134211.1| PREDICTED: 40S ribosomal protein S21-2-like isoform 3 [Cucumis sativus] Length = 82 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -3 Query: 224 TFALCGFIRAQGDADGALDRLWQKKKVETRQQ 129 TFALCGFIRAQGDAD ALDRLWQKKKVE RQQ Sbjct: 51 TFALCGFIRAQGDADSALDRLWQKKKVEVRQQ 82 >ref|XP_002512424.1| 40S ribosomal protein S21e, putative [Ricinus communis] gi|223548385|gb|EEF49876.1| 40S ribosomal protein S21e, putative [Ricinus communis] gi|313586443|gb|ADR71232.1| 40S ribosomal protein S21A [Hevea brasiliensis] Length = 82 Score = 64.7 bits (156), Expect = 8e-09 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 224 TFALCGFIRAQGDADGALDRLWQKKKVETRQQ 129 TFALCGF+RAQGDAD ALDRLWQKKKVE RQQ Sbjct: 51 TFALCGFVRAQGDADSALDRLWQKKKVELRQQ 82 >ref|XP_003546356.1| PREDICTED: 40S ribosomal protein S21-like [Glycine max] gi|255626485|gb|ACU13587.1| unknown [Glycine max] Length = 82 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 224 TFALCGFIRAQGDADGALDRLWQKKKVETRQQ 129 TFALCGFIRAQGDAD ALDRLWQKKKVE +QQ Sbjct: 51 TFALCGFIRAQGDADSALDRLWQKKKVEVKQQ 82 >ref|XP_003533393.1| PREDICTED: 40S ribosomal protein S21 [Glycine max] gi|255627837|gb|ACU14263.1| unknown [Glycine max] Length = 82 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -3 Query: 224 TFALCGFIRAQGDADGALDRLWQKKKVETRQQ 129 TFALCGFIRAQGDAD ALDRLWQKKKVE +QQ Sbjct: 51 TFALCGFIRAQGDADSALDRLWQKKKVEVKQQ 82