BLASTX nr result
ID: Scutellaria22_contig00004075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00004075 (628 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301250.1| predicted protein [Populus trichocarpa] gi|2... 103 3e-26 ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-like is... 104 6e-26 ref|XP_002268465.1| PREDICTED: 60S ribosomal protein L15-like [V... 102 2e-25 ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus com... 102 2e-25 emb|CAN68893.1| hypothetical protein VITISV_004609 [Vitis vinifera] 102 2e-25 >ref|XP_002301250.1| predicted protein [Populus trichocarpa] gi|224137010|ref|XP_002327000.1| predicted protein [Populus trichocarpa] gi|222835315|gb|EEE73750.1| predicted protein [Populus trichocarpa] gi|222842976|gb|EEE80523.1| predicted protein [Populus trichocarpa] Length = 204 Score = 103 bits (257), Expect(2) = 3e-26 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -3 Query: 623 AHTTIRNDPRINWVCNPVHKHRELRGLTSAGKKYRGLRGKGHLNHKARP 477 AH IRNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRG+GHL+HKARP Sbjct: 138 AHNAIRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARP 186 Score = 40.8 bits (94), Expect(2) = 3e-26 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -1 Query: 418 LNHKARPSRRATWKRNQT 365 L+HKARPSRRATWKRNQT Sbjct: 180 LHHKARPSRRATWKRNQT 197 >ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis sativus] gi|449458363|ref|XP_004146917.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis sativus] gi|449520285|ref|XP_004167164.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis sativus] gi|449520287|ref|XP_004167165.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis sativus] Length = 204 Score = 104 bits (259), Expect(2) = 6e-26 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -3 Query: 623 AHTTIRNDPRINWVCNPVHKHRELRGLTSAGKKYRGLRGKGHLNHKARP 477 AH +RNDPRINW+CNPVHKHRELRGLTSAGKKYRGLRGKGHL+HKARP Sbjct: 138 AHNAVRNDPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARP 186 Score = 38.9 bits (89), Expect(2) = 6e-26 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 418 LNHKARPSRRATWKRNQT 365 L+HKARPSRRATWKRN T Sbjct: 180 LHHKARPSRRATWKRNNT 197 >ref|XP_002268465.1| PREDICTED: 60S ribosomal protein L15-like [Vitis vinifera] Length = 204 Score = 102 bits (254), Expect(2) = 2e-25 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -3 Query: 623 AHTTIRNDPRINWVCNPVHKHRELRGLTSAGKKYRGLRGKGHLNHKARP 477 AH IRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRGKGHL+HKARP Sbjct: 138 AHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARP 186 Score = 38.9 bits (89), Expect(2) = 2e-25 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 418 LNHKARPSRRATWKRNQT 365 L+HKARPSRRATWKRN T Sbjct: 180 LHHKARPSRRATWKRNNT 197 >ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus communis] gi|223550092|gb|EEF51579.1| ribosomal protein L15, putative [Ricinus communis] Length = 204 Score = 102 bits (254), Expect(2) = 2e-25 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -3 Query: 623 AHTTIRNDPRINWVCNPVHKHRELRGLTSAGKKYRGLRGKGHLNHKARP 477 AH IRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRGKGHL+HKARP Sbjct: 138 AHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARP 186 Score = 38.9 bits (89), Expect(2) = 2e-25 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 418 LNHKARPSRRATWKRNQT 365 L+HKARPSRRATWKRN T Sbjct: 180 LHHKARPSRRATWKRNNT 197 >emb|CAN68893.1| hypothetical protein VITISV_004609 [Vitis vinifera] Length = 204 Score = 102 bits (254), Expect(2) = 2e-25 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = -3 Query: 623 AHTTIRNDPRINWVCNPVHKHRELRGLTSAGKKYRGLRGKGHLNHKARP 477 AH IRNDPRINW+C PVHKHRELRGLTSAGKKYRGLRGKGHL+HKARP Sbjct: 138 AHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARP 186 Score = 38.9 bits (89), Expect(2) = 2e-25 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -1 Query: 418 LNHKARPSRRATWKRNQT 365 L+HKARPSRRATWKRN T Sbjct: 180 LHHKARPSRRATWKRNNT 197