BLASTX nr result
ID: Scutellaria22_contig00002840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00002840 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136411.1| PREDICTED: receptor-like protein kinase HSL1... 91 7e-17 gb|ACI42311.1| putative leucine rich repeat transmembrane protei... 90 2e-16 gb|AEP84281.1| leucine rich repeat-containing protein [Corchorus... 89 3e-16 ref|XP_002510008.1| receptor protein kinase, putative [Ricinus c... 89 4e-16 ref|XP_002283600.2| PREDICTED: receptor-like protein kinase HSL1... 83 2e-14 >ref|XP_004136411.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus] gi|449516063|ref|XP_004165067.1| PREDICTED: receptor-like protein kinase HSL1-like [Cucumis sativus] Length = 947 Score = 91.3 bits (225), Expect = 7e-17 Identities = 47/76 (61%), Positives = 57/76 (75%) Frame = +1 Query: 1 WISTKVEETKDGAKEVLDKRVSGLYNEDMIKVLGIAIRCTNKAPTLRPTMNEAVQQLIEA 180 W+S KV+ TK+GA EVLDKRVS + ++MI+VL IAIRCT K P LRPTM E VQ LIEA Sbjct: 864 WVSNKVD-TKEGAMEVLDKRVSCSFKDEMIEVLRIAIRCTYKNPALRPTMKEVVQLLIEA 922 Query: 181 EPCKFNCCTWKSKEST 228 +PCKF+ SK +T Sbjct: 923 DPCKFDSHNKSSKHTT 938 >gb|ACI42311.1| putative leucine rich repeat transmembrane protein kinase [Corchorus olitorius] Length = 957 Score = 89.7 bits (221), Expect = 2e-16 Identities = 43/77 (55%), Positives = 59/77 (76%) Frame = +1 Query: 1 WISTKVEETKDGAKEVLDKRVSGLYNEDMIKVLGIAIRCTNKAPTLRPTMNEAVQQLIEA 180 WISTK++ TK+G EVLDK++SG + ++MI+VL IA+RCT K P+ RPTMNE VQ LIEA Sbjct: 868 WISTKLD-TKEGVMEVLDKQLSGSFRDEMIQVLRIAMRCTCKNPSQRPTMNEVVQLLIEA 926 Query: 181 EPCKFNCCTWKSKESTE 231 +PC+ + C S ++ E Sbjct: 927 DPCRLDSCKLSSNKTKE 943 >gb|AEP84281.1| leucine rich repeat-containing protein [Corchorus capsularis] Length = 958 Score = 89.4 bits (220), Expect = 3e-16 Identities = 43/77 (55%), Positives = 59/77 (76%) Frame = +1 Query: 1 WISTKVEETKDGAKEVLDKRVSGLYNEDMIKVLGIAIRCTNKAPTLRPTMNEAVQQLIEA 180 WISTK++ TK+G EVLDK++SG + ++MI+VL IA+RCT K P+ RPTMNE VQ LIEA Sbjct: 869 WISTKLD-TKEGVMEVLDKQLSGSFRDEMIQVLRIAMRCTCKNPSQRPTMNEVVQLLIEA 927 Query: 181 EPCKFNCCTWKSKESTE 231 +PC+ + C S ++ E Sbjct: 928 DPCRLDSCKLTSNKTKE 944 >ref|XP_002510008.1| receptor protein kinase, putative [Ricinus communis] gi|223550709|gb|EEF52195.1| receptor protein kinase, putative [Ricinus communis] Length = 956 Score = 89.0 bits (219), Expect = 4e-16 Identities = 44/73 (60%), Positives = 55/73 (75%) Frame = +1 Query: 1 WISTKVEETKDGAKEVLDKRVSGLYNEDMIKVLGIAIRCTNKAPTLRPTMNEAVQQLIEA 180 W+STKVE TK+G EVLDK++SG + +MI+VL IAIRC K P RPTMNE VQ LIEA Sbjct: 869 WVSTKVE-TKEGVMEVLDKKLSGSFWNEMIQVLRIAIRCICKTPAPRPTMNEVVQLLIEA 927 Query: 181 EPCKFNCCTWKSK 219 +PC+F+ C +K Sbjct: 928 DPCRFDSCKSSNK 940 >ref|XP_002283600.2| PREDICTED: receptor-like protein kinase HSL1-like [Vitis vinifera] Length = 956 Score = 83.2 bits (204), Expect = 2e-14 Identities = 39/78 (50%), Positives = 59/78 (75%), Gaps = 2/78 (2%) Frame = +1 Query: 1 WISTKVEETKDGAKEVLDKRVSGLYNEDMIKVLGIAIRCTNKAPTLRPTMNEAVQQLIEA 180 W++TKV T +GA EVLDKR+SG + ++M+++L I +RCT+ +P LRPTMNE Q L EA Sbjct: 869 WVATKVG-TMEGAMEVLDKRLSGSFRDEMLQMLRIGLRCTSSSPALRPTMNEVAQLLTEA 927 Query: 181 EPCKFNCC--TWKSKEST 228 +PC+ + C + K+KE++ Sbjct: 928 DPCRVDSCKLSCKTKETS 945