BLASTX nr result
ID: Scutellaria22_contig00000287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria22_contig00000287 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA47950.1| chlorophyll a/b binding protein [Pinus contorta] 63 2e-08 ref|XP_003574911.1| PREDICTED: uncharacterized protein LOC100846... 63 2e-08 emb|CAC38830.1| chlorophyll a/b binding protein [Pinus contorta] 63 2e-08 ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein o... 63 3e-08 ref|XP_004155624.1| PREDICTED: chlorophyll a-b binding protein o... 63 3e-08 >emb|CAA47950.1| chlorophyll a/b binding protein [Pinus contorta] Length = 274 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 304 PLENLADHLADPVSNNAWAYATNFVPGK 221 P+ENLADHLADPVSNNAWAYATNFVPGK Sbjct: 247 PIENLADHLADPVSNNAWAYATNFVPGK 274 >ref|XP_003574911.1| PREDICTED: uncharacterized protein LOC100846020 [Brachypodium distachyon] Length = 560 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 304 PLENLADHLADPVSNNAWAYATNFVPGK*GLSP 206 PLENLADHLADPV+NNAWA+ATNFVPGK L P Sbjct: 233 PLENLADHLADPVNNNAWAFATNFVPGKEELEP 265 >emb|CAC38830.1| chlorophyll a/b binding protein [Pinus contorta] Length = 274 Score = 63.2 bits (152), Expect = 2e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 304 PLENLADHLADPVSNNAWAYATNFVPGK 221 P+ENLADHLADPVSNNAWAYATNFVPGK Sbjct: 247 PIENLADHLADPVSNNAWAYATNFVPGK 274 >ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like [Cucumis sativus] Length = 265 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 304 PLENLADHLADPVSNNAWAYATNFVPGK 221 PLENLADHLADPV+NNAWAYATNFVPGK Sbjct: 238 PLENLADHLADPVNNNAWAYATNFVPGK 265 >ref|XP_004155624.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like [Cucumis sativus] Length = 153 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 304 PLENLADHLADPVSNNAWAYATNFVPGK 221 PLENLADHLADPV+NNAWAYATNFVPGK Sbjct: 126 PLENLADHLADPVNNNAWAYATNFVPGK 153