BLASTX nr result
ID: Salvia21_contig00042299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00042299 (669 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309974.1| predicted protein [Populus trichocarpa] gi|2... 69 8e-10 gb|ABK95203.1| unknown [Populus trichocarpa] 69 8e-10 ref|NP_196591.2| putative LRR receptor-like serine/threonine-pro... 67 4e-09 ref|XP_002873449.1| leucine-rich repeat family protein [Arabidop... 67 4e-09 gb|AAM13028.1| protein serine/threonine kinase-like protein [Ara... 67 4e-09 >ref|XP_002309974.1| predicted protein [Populus trichocarpa] gi|222852877|gb|EEE90424.1| predicted protein [Populus trichocarpa] Length = 611 Score = 68.9 bits (167), Expect = 8e-10 Identities = 34/45 (75%), Positives = 38/45 (84%), Gaps = 5/45 (11%) Frame = -2 Query: 161 SGDVDQRIEFGQLKRFSWRELQLATDGFSEKNVL-----GKVHKG 42 +G+VDQRI FGQLKRFSWRELQLATD FSEKN+L GKV+KG Sbjct: 261 AGEVDQRIAFGQLKRFSWRELQLATDNFSEKNILGQGGFGKVYKG 305 >gb|ABK95203.1| unknown [Populus trichocarpa] Length = 611 Score = 68.9 bits (167), Expect = 8e-10 Identities = 34/45 (75%), Positives = 38/45 (84%), Gaps = 5/45 (11%) Frame = -2 Query: 161 SGDVDQRIEFGQLKRFSWRELQLATDGFSEKNVL-----GKVHKG 42 +G+VDQRI FGQLKRFSWRELQLATD FSEKN+L GKV+KG Sbjct: 261 AGEVDQRIAFGQLKRFSWRELQLATDNFSEKNILGQGGFGKVYKG 305 >ref|NP_196591.2| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] gi|264664527|sp|C0LGT1.1|Y5129_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At5g10290; Flags: Precursor gi|224589669|gb|ACN59366.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332004134|gb|AED91517.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] Length = 613 Score = 66.6 bits (161), Expect = 4e-09 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 5/45 (11%) Frame = -2 Query: 161 SGDVDQRIEFGQLKRFSWRELQLATDGFSEKNVL-----GKVHKG 42 +G+VD+RI FGQLKRF+WRELQLATD FSEKNVL GKV+KG Sbjct: 263 AGEVDRRIAFGQLKRFAWRELQLATDNFSEKNVLGQGGFGKVYKG 307 >ref|XP_002873449.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297319286|gb|EFH49708.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 613 Score = 66.6 bits (161), Expect = 4e-09 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 5/45 (11%) Frame = -2 Query: 161 SGDVDQRIEFGQLKRFSWRELQLATDGFSEKNVL-----GKVHKG 42 +G+VD+RI FGQLKRF+WRELQLATD FSEKNVL GKV+KG Sbjct: 263 AGEVDRRIAFGQLKRFAWRELQLATDNFSEKNVLGQGGFGKVYKG 307 >gb|AAM13028.1| protein serine/threonine kinase-like protein [Arabidopsis thaliana] Length = 613 Score = 66.6 bits (161), Expect = 4e-09 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 5/45 (11%) Frame = -2 Query: 161 SGDVDQRIEFGQLKRFSWRELQLATDGFSEKNVL-----GKVHKG 42 +G+VD+RI FGQLKRF+WRELQLATD FSEKNVL GKV+KG Sbjct: 263 AGEVDRRIAFGQLKRFAWRELQLATDNFSEKNVLGQGGFGKVYKG 307