BLASTX nr result
ID: Salvia21_contig00041961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00041961 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510108.1| zinc finger protein, putative [Ricinus commu... 62 4e-08 gb|AFW88133.1| hypothetical protein ZEAMMB73_893978 [Zea mays] 61 1e-07 dbj|BAA21927.1| ZPT3-3 [Petunia x hybrida] gi|7959293|dbj|BAA960... 60 1e-07 gb|ACD13216.1| zinc finger protein [Cicer arietinum] 60 1e-07 ref|XP_003525454.1| PREDICTED: uncharacterized protein LOC100781... 60 2e-07 >ref|XP_002510108.1| zinc finger protein, putative [Ricinus communis] gi|223550809|gb|EEF52295.1| zinc finger protein, putative [Ricinus communis] Length = 256 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/85 (35%), Positives = 51/85 (60%) Frame = -2 Query: 269 EEVALSLILLSMDNSNNTSFDESNSNSRDPRKRSKINDQSEVNSPKIPPSDDNKKCKFRC 90 E +AL L++L+ ++ + S ++ R + + P++P S D++K +++C Sbjct: 49 EYLALCLVMLARGTTSLAALSTSTTSHR--------HRSPTPSPPQLPSSSDDQKHRYKC 100 Query: 89 MICNKAFPSSQALGGHRASHKKFKG 15 +CNKAF S QALGGH+ASH+K G Sbjct: 101 TVCNKAFSSYQALGGHKASHRKLAG 125 >gb|AFW88133.1| hypothetical protein ZEAMMB73_893978 [Zea mays] Length = 379 Score = 60.8 bits (146), Expect = 1e-07 Identities = 38/98 (38%), Positives = 56/98 (57%), Gaps = 10/98 (10%) Frame = -2 Query: 269 EEVALSLILLSMDN------SNNTSFDESNSNSRDPR--KRSKINDQSEVNSPKIPPS-- 120 E+VALSL++LS D S T+ +++ RD R + + ND +++N K S Sbjct: 170 EDVALSLMMLSRDIIERRRCSRATAEEDNARRERDYRYHQHTDCNDDAKINKRKHDHSLV 229 Query: 119 DDNKKCKFRCMICNKAFPSSQALGGHRASHKKFKGCCA 6 D K+ ++ C C +AF S QALGGHRASHK+ C+ Sbjct: 230 IDEKRGRYECPGCRRAFQSYQALGGHRASHKRINSNCS 267 >dbj|BAA21927.1| ZPT3-3 [Petunia x hybrida] gi|7959293|dbj|BAA96071.1| C2H2 zinc-finger protein ZPT3-3 [Petunia x hybrida] Length = 300 Score = 60.5 bits (145), Expect = 1e-07 Identities = 36/85 (42%), Positives = 48/85 (56%), Gaps = 1/85 (1%) Frame = -2 Query: 269 EEVALSLILLSMDNSNNTSFDESNSNSRDPRKRSKINDQSEV-NSPKIPPSDDNKKCKFR 93 E+VA L++LS D +D+ + + + K + +V NS KI S + K+R Sbjct: 120 EDVAHCLMMLSRDKWIKQEYDDYSDDDEEEEKSEDSGELVKVTNSTKIKGS----RGKYR 175 Query: 92 CMICNKAFPSSQALGGHRASHKKFK 18 C CNK F S QALGGHRASHKK K Sbjct: 176 CETCNKVFRSYQALGGHRASHKKIK 200 >gb|ACD13216.1| zinc finger protein [Cicer arietinum] Length = 280 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/82 (39%), Positives = 47/82 (57%) Frame = -2 Query: 269 EEVALSLILLSMDNSNNTSFDESNSNSRDPRKRSKINDQSEVNSPKIPPSDDNKKCKFRC 90 E +AL LI+L+ +N + ++ S+ + + S Q + + P P K RC Sbjct: 51 EYLALCLIMLAQSGNNRNNKNDIVSHFHNQIESSSSQSQQQPSPPSPPV-----KLNHRC 105 Query: 89 MICNKAFPSSQALGGHRASHKK 24 +CNKAFPS QALGGH+ASH+K Sbjct: 106 TVCNKAFPSYQALGGHKASHRK 127 >ref|XP_003525454.1| PREDICTED: uncharacterized protein LOC100781747 [Glycine max] Length = 997 Score = 60.1 bits (144), Expect = 2e-07 Identities = 32/64 (50%), Positives = 38/64 (59%) Frame = -2 Query: 197 SNSRDPRKRSKINDQSEVNSPKIPPSDDNKKCKFRCMICNKAFPSSQALGGHRASHKKFK 18 S S ++ ++ SE S K + NK+ KF C CNK F S QALGGHRASHKK K Sbjct: 362 SGSELKSNKNWMDKASEAESSK----NSNKRGKFECTTCNKIFHSYQALGGHRASHKKIK 417 Query: 17 GCCA 6 GC A Sbjct: 418 GCFA 421