BLASTX nr result
ID: Salvia21_contig00041570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00041570 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313634.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 ref|XP_002515850.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_003592245.1| Double-stranded RNA binding protein [Medicag... 56 3e-06 ref|XP_003601344.1| Double-stranded RNA binding protein [Medicag... 55 6e-06 >ref|XP_002313634.1| predicted protein [Populus trichocarpa] gi|222850042|gb|EEE87589.1| predicted protein [Populus trichocarpa] Length = 484 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/58 (48%), Positives = 41/58 (70%) Frame = +3 Query: 129 SYPQPKHESIGESEMKSSYLLCNRVRVFTCMPNVALPEGTLVLPISEDRWAMVALEFP 302 S P ++ ++ + SYLLCNRVRV+ C P++ALP G V+PIS+++W V+LEFP Sbjct: 422 SAPTISDSNVRKATRQRSYLLCNRVRVYPCYPDIALPNGITVMPISDNQWVAVSLEFP 479 >ref|XP_002515850.1| conserved hypothetical protein [Ricinus communis] gi|223545005|gb|EEF46519.1| conserved hypothetical protein [Ricinus communis] Length = 284 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/51 (49%), Positives = 35/51 (68%) Frame = +3 Query: 153 SIGESEMKSSYLLCNRVRVFTCMPNVALPEGTLVLPISEDRWAMVALEFPN 305 ++G+ E SYLLC RVR++ PN+ P+G VLPI+++ W V LEFPN Sbjct: 230 NMGKPEAPESYLLCERVRMYPSYPNIDFPKGITVLPITDNIWVAVNLEFPN 280 >ref|XP_003592245.1| Double-stranded RNA binding protein [Medicago truncatula] gi|357462121|ref|XP_003601342.1| Double-stranded RNA binding protein [Medicago truncatula] gi|355481293|gb|AES62496.1| Double-stranded RNA binding protein [Medicago truncatula] gi|355490390|gb|AES71593.1| Double-stranded RNA binding protein [Medicago truncatula] Length = 424 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/69 (39%), Positives = 39/69 (56%), Gaps = 5/69 (7%) Frame = +3 Query: 114 ESCDISYPQPKHESIGESEMK-----SSYLLCNRVRVFTCMPNVALPEGTLVLPISEDRW 278 +S +S+ + +I +S M S+YLLC+R V+T P++ PE VLP ED+W Sbjct: 349 KSSPLSHTELASSTISDSNMTMTCNTSNYLLCDRFNVYTNFPDILFPEDITVLPFDEDKW 408 Query: 279 AMVALEFPN 305 LEFPN Sbjct: 409 VAACLEFPN 417 >ref|XP_003601344.1| Double-stranded RNA binding protein [Medicago truncatula] gi|355490392|gb|AES71595.1| Double-stranded RNA binding protein [Medicago truncatula] Length = 372 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/62 (40%), Positives = 40/62 (64%), Gaps = 4/62 (6%) Frame = +3 Query: 129 SYPQPKHESIGESEMKS----SYLLCNRVRVFTCMPNVALPEGTLVLPISEDRWAMVALE 296 S P P ++ + S+ K+ SY+L N+++V+T P++ PEG V+PI ED+W +LE Sbjct: 310 SLPLPPNKKMKISKAKTPNTNSYMLGNKLKVYTSFPDIVFPEGITVVPIGEDKWIAASLE 369 Query: 297 FP 302 FP Sbjct: 370 FP 371