BLASTX nr result
ID: Salvia21_contig00041319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00041319 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531110.1| conserved hypothetical protein [Ricinus comm... 136 2e-30 emb|CAN80353.1| hypothetical protein VITISV_003141 [Vitis vinifera] 112 4e-23 ref|XP_003606612.1| hypothetical protein MTR_4g063070 [Medicago ... 104 7e-21 ref|XP_003597323.1| RING finger family protein [Medicago truncat... 94 9e-18 ref|XP_002513984.1| ring finger protein, putative [Ricinus commu... 85 7e-15 >ref|XP_002531110.1| conserved hypothetical protein [Ricinus communis] gi|223529306|gb|EEF31275.1| conserved hypothetical protein [Ricinus communis] Length = 199 Score = 136 bits (342), Expect = 2e-30 Identities = 62/106 (58%), Positives = 81/106 (76%) Frame = +1 Query: 1 LPITQIKKCKDTEPNLSSWECAVCLGEFEQGEWVKHLPICSHVFHVSCIDTWFQTHDSCP 180 LPITQ K K+ EP +S+ ECAVCLGE+E+GEW+KHLP C+HVFHV+CIDTWFQTH +CP Sbjct: 72 LPITQFKNKKEEEPRVSNNECAVCLGEYEEGEWLKHLPNCAHVFHVACIDTWFQTHSNCP 131 Query: 181 LCRSYVCHPNTPPQSSININIYLQTLNREDFHRHTSQHYQERRDDL 318 LCRS+V + + S++INI L+T REDF +S+ YQ R ++ Sbjct: 132 LCRSHVY--DLSHEYSMSINILLETPRREDFFHESSEDYQILRAEI 175 >emb|CAN80353.1| hypothetical protein VITISV_003141 [Vitis vinifera] Length = 209 Score = 112 bits (279), Expect = 4e-23 Identities = 52/99 (52%), Positives = 70/99 (70%) Frame = +1 Query: 1 LPITQIKKCKDTEPNLSSWECAVCLGEFEQGEWVKHLPICSHVFHVSCIDTWFQTHDSCP 180 LPI Q KK + P+ S+ +CAVCLGEFE+GE++KHLP CSHVFH+ CIDTWF++H +CP Sbjct: 42 LPIAQFKK--NEGPSHSNTDCAVCLGEFEEGEFLKHLPNCSHVFHIPCIDTWFESHSNCP 99 Query: 181 LCRSYVCHPNTPPQSSININIYLQTLNREDFHRHTSQHY 297 LCRS+V + S ++ L+TL REDF + Q + Sbjct: 100 LCRSHVYDFTMDNEFSGSMYTLLETLRREDFFQEWIQRF 138 >ref|XP_003606612.1| hypothetical protein MTR_4g063070 [Medicago truncatula] gi|355507667|gb|AES88809.1| hypothetical protein MTR_4g063070 [Medicago truncatula] Length = 396 Score = 104 bits (260), Expect = 7e-21 Identities = 44/66 (66%), Positives = 53/66 (80%) Frame = +1 Query: 1 LPITQIKKCKDTEPNLSSWECAVCLGEFEQGEWVKHLPICSHVFHVSCIDTWFQTHDSCP 180 LP+ Q KK + E LS +CA+CLGEFE+GEWVKHLPIC+H FHVSCID WFQ+H +CP Sbjct: 317 LPMFQFKK-NEVEQKLSDVDCAICLGEFEEGEWVKHLPICTHSFHVSCIDKWFQSHSNCP 375 Query: 181 LCRSYV 198 LCR +V Sbjct: 376 LCRCHV 381 >ref|XP_003597323.1| RING finger family protein [Medicago truncatula] gi|355486371|gb|AES67574.1| RING finger family protein [Medicago truncatula] Length = 219 Score = 94.4 bits (233), Expect = 9e-18 Identities = 47/101 (46%), Positives = 64/101 (63%), Gaps = 1/101 (0%) Frame = +1 Query: 1 LPITQIKKCKDTEPNLSSWECAVCLGEFEQGEWVKHLPICSHVFHVSCIDTWFQTHDSCP 180 LP+ Q KK + E ++ +CA+CLGEFE GE +K LP C+H FHVSCID WFQ H SCP Sbjct: 116 LPMYQFKKNEAQEMTINV-DCAICLGEFEGGELLKLLPNCNHGFHVSCIDKWFQLHSSCP 174 Query: 181 LCRSYVCHPNTP-PQSSININIYLQTLNREDFHRHTSQHYQ 300 LCRS V + S+++N +L+ L +D + H+Q Sbjct: 175 LCRSRVYRVLVANNEYSVSLNTWLEILGMDDITPERNAHFQ 215 >ref|XP_002513984.1| ring finger protein, putative [Ricinus communis] gi|223547070|gb|EEF48567.1| ring finger protein, putative [Ricinus communis] Length = 393 Score = 84.7 bits (208), Expect = 7e-15 Identities = 37/74 (50%), Positives = 50/74 (67%), Gaps = 1/74 (1%) Frame = +1 Query: 22 KCKDTEPNLSSWECAVCLGEFEQGEWVKHLPICSHVFHVSCIDTWFQTHDSCPLCRSYVC 201 K K E + EC+VCL EF+Q E ++ LP C+H FH+SCIDTW ++H +CPLCR+++ Sbjct: 138 KYKKGEGLIEGTECSVCLSEFQQDETLRLLPKCNHAFHISCIDTWLRSHTNCPLCRAHIV 197 Query: 202 HPNTP-PQSSININ 240 H P P SIN N Sbjct: 198 HDPVPTPLISINQN 211