BLASTX nr result
ID: Salvia21_contig00040910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00040910 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522044.1| kinase, putative [Ricinus communis] gi|22353... 79 3e-13 ref|XP_002262748.1| PREDICTED: L-type lectin-domain containing r... 77 1e-12 ref|XP_002310341.1| predicted protein [Populus trichocarpa] gi|2... 77 1e-12 emb|CAN70210.1| hypothetical protein VITISV_007747 [Vitis vinifera] 77 1e-12 ref|XP_003551295.1| PREDICTED: L-type lectin-domain containing r... 76 2e-12 >ref|XP_002522044.1| kinase, putative [Ricinus communis] gi|223538643|gb|EEF40244.1| kinase, putative [Ricinus communis] Length = 606 Score = 79.3 bits (194), Expect = 3e-13 Identities = 31/49 (63%), Positives = 41/49 (83%) Frame = +2 Query: 2 LMVVGLWCAHPDDTLRPSIKEVVRLLGFEAEPPLLPSKMPVPTYSAPPP 148 LM++GLWCAHPD+ LRPSI++ + +L FEA P+LP +MP+PTY APPP Sbjct: 524 LMIIGLWCAHPDENLRPSIRQAIHVLHFEAPLPILPPEMPIPTYFAPPP 572 >ref|XP_002262748.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Vitis vinifera] Length = 720 Score = 77.0 bits (188), Expect = 1e-12 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = +2 Query: 2 LMVVGLWCAHPDDTLRPSIKEVVRLLGFEAEPPLLPSKMPVPTYSAP 142 LM VGLWCAHPD LRPS++EV+ +L FEA P+LP KMPVPTYS P Sbjct: 622 LMTVGLWCAHPDRNLRPSVREVIHVLNFEAPLPILPPKMPVPTYSIP 668 >ref|XP_002310341.1| predicted protein [Populus trichocarpa] gi|222853244|gb|EEE90791.1| predicted protein [Populus trichocarpa] Length = 692 Score = 77.0 bits (188), Expect = 1e-12 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +2 Query: 2 LMVVGLWCAHPDDTLRPSIKEVVRLLGFEAEPPLLPSKMPVPTYSAPP 145 LM+VGLWC HPD TLRPSI++V+ +L FEA P LPSK+PVP Y APP Sbjct: 593 LMIVGLWCCHPDYTLRPSIRQVINVLNFEAPLPTLPSKLPVPMYYAPP 640 >emb|CAN70210.1| hypothetical protein VITISV_007747 [Vitis vinifera] Length = 692 Score = 77.0 bits (188), Expect = 1e-12 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = +2 Query: 2 LMVVGLWCAHPDDTLRPSIKEVVRLLGFEAEPPLLPSKMPVPTYSAP 142 LM VGLWCAHPD LRPS++EV+ +L FEA P+LP KMPVPTYS P Sbjct: 594 LMTVGLWCAHPDRNLRPSVREVIHVLNFEAPLPILPPKMPVPTYSIP 640 >ref|XP_003551295.1| PREDICTED: L-type lectin-domain containing receptor kinase IX.1-like [Glycine max] Length = 679 Score = 76.3 bits (186), Expect = 2e-12 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = +2 Query: 2 LMVVGLWCAHPDDTLRPSIKEVVRLLGFEAEPPLLPSKMPVPTYSAPP 145 LM+VGLWC HPD T+RPSI++V+ +L FEA P LPSK+PVP Y APP Sbjct: 595 LMIVGLWCCHPDHTMRPSIRQVISVLNFEAPLPSLPSKLPVPMYYAPP 642