BLASTX nr result
ID: Salvia21_contig00040771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00040771 (532 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514322.1| conserved hypothetical protein [Ricinus comm... 62 5e-08 ref|XP_003629642.1| hypothetical protein MTR_8g083460 [Medicago ... 58 1e-06 >ref|XP_002514322.1| conserved hypothetical protein [Ricinus communis] gi|223546778|gb|EEF48276.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 62.0 bits (149), Expect = 5e-08 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +2 Query: 281 GGQPAEEGGGVVKVCLCSPTSHPGSFRCRQHHGEYQWVNRL 403 G A GGG +K+C+CSPT HPGSFRCR HH +Y W R+ Sbjct: 47 GSADAGGGGGSIKMCVCSPTRHPGSFRCRHHHVDYAWGRRI 87 >ref|XP_003629642.1| hypothetical protein MTR_8g083460 [Medicago truncatula] gi|357521031|ref|XP_003630804.1| hypothetical protein MTR_8g103600 [Medicago truncatula] gi|355523664|gb|AET04118.1| hypothetical protein MTR_8g083460 [Medicago truncatula] gi|355524826|gb|AET05280.1| hypothetical protein MTR_8g103600 [Medicago truncatula] Length = 83 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/51 (54%), Positives = 33/51 (64%), Gaps = 6/51 (11%) Frame = +2 Query: 266 PVVNMGGQPAEEGG------GVVKVCLCSPTSHPGSFRCRQHHGEYQWVNR 400 PVV + GQ A GG G +K C+CSP+ HPGSFRCRQH +Y W NR Sbjct: 31 PVVVVAGQ-ARGGGDRAGEDGSIKQCVCSPSKHPGSFRCRQHQAKYVWRNR 80