BLASTX nr result
ID: Salvia21_contig00040525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00040525 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588269.1| Mitochondrial protein, putative [Medicago tr... 64 2e-08 >ref|XP_003588269.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477317|gb|AES58520.1| Mitochondrial protein, putative [Medicago truncatula] Length = 172 Score = 63.5 bits (153), Expect = 2e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = +3 Query: 3 YVRLVD*TIRYTTPRIIPSFHRGKIKKKKRYSDRA 107 YVRLVD TIRYTTPRIIPSF+RG+IKKKKR SDRA Sbjct: 4 YVRLVDQTIRYTTPRIIPSFYRGEIKKKKRDSDRA 38