BLASTX nr result
ID: Salvia21_contig00039851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00039851 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004156921.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 59 4e-07 ref|XP_004145647.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 59 4e-07 ref|XP_002519954.1| conserved hypothetical protein [Ricinus comm... 59 4e-07 emb|CBI21809.3| unnamed protein product [Vitis vinifera] 58 9e-07 ref|XP_002269838.1| PREDICTED: uncharacterized protein LOC100257... 58 9e-07 >ref|XP_004156921.1| PREDICTED: UPF0420 protein C16orf58 homolog [Cucumis sativus] Length = 443 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 104 LIQVATRSCFYAEFVAQRNFVEVMAKGEAQGMV 202 LIQ ATRSCFYA F AQRNF EV+AKGEAQGMV Sbjct: 307 LIQAATRSCFYAGFAAQRNFAEVIAKGEAQGMV 339 >ref|XP_004145647.1| PREDICTED: UPF0420 protein C16orf58 homolog [Cucumis sativus] Length = 611 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 104 LIQVATRSCFYAEFVAQRNFVEVMAKGEAQGMV 202 LIQ ATRSCFYA F AQRNF EV+AKGEAQGMV Sbjct: 337 LIQAATRSCFYAGFAAQRNFAEVIAKGEAQGMV 369 >ref|XP_002519954.1| conserved hypothetical protein [Ricinus communis] gi|223541000|gb|EEF42558.1| conserved hypothetical protein [Ricinus communis] Length = 541 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 104 LIQVATRSCFYAEFVAQRNFVEVMAKGEAQGMV 202 LIQ ATRSCFYA F AQRNF EV+AKGEAQGMV Sbjct: 262 LIQAATRSCFYAGFAAQRNFAEVIAKGEAQGMV 294 >emb|CBI21809.3| unnamed protein product [Vitis vinifera] Length = 537 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 104 LIQVATRSCFYAEFVAQRNFVEVMAKGEAQGMV 202 LIQ +TRSCFYA F AQRNF EV+AKGEAQGMV Sbjct: 213 LIQASTRSCFYAGFAAQRNFAEVIAKGEAQGMV 245 >ref|XP_002269838.1| PREDICTED: uncharacterized protein LOC100257731 [Vitis vinifera] Length = 713 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +2 Query: 104 LIQVATRSCFYAEFVAQRNFVEVMAKGEAQGMV 202 LIQ +TRSCFYA F AQRNF EV+AKGEAQGMV Sbjct: 415 LIQASTRSCFYAGFAAQRNFAEVIAKGEAQGMV 447