BLASTX nr result
ID: Salvia21_contig00039387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00039387 (404 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274464.1| PREDICTED: uncharacterized protein LOC100256... 57 2e-06 >ref|XP_002274464.1| PREDICTED: uncharacterized protein LOC100256132 [Vitis vinifera] Length = 106 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +1 Query: 1 ISKFLIASILMWTVPIAVLYGFNHNLFPGNLPLTT 105 I KF IAS+LMW PIA+LYGFNHNLFPG+ L++ Sbjct: 5 IKKFFIASMLMWIAPIAILYGFNHNLFPGSTQLSS 39