BLASTX nr result
ID: Salvia21_contig00039202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00039202 (442 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74960.1| hypothetical protein VITISV_023063 [Vitis vinifera] 68 9e-10 ref|XP_002534237.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >emb|CAN74960.1| hypothetical protein VITISV_023063 [Vitis vinifera] Length = 122 Score = 67.8 bits (164), Expect = 9e-10 Identities = 34/57 (59%), Positives = 41/57 (71%), Gaps = 4/57 (7%) Frame = +1 Query: 106 ASRPLGSKLEDYTTFKPKVIKP-KHG---FGVEGCMPKGRRHSSAPSRYINYEPLDS 264 A+RPLGSK ++Y T KPK + P +HG VEGC+PKG R SSAPSRY+NY L S Sbjct: 34 ATRPLGSKAQEYVTLKPKFLSPGQHGPQNGNVEGCLPKGFRRSSAPSRYVNYHVLGS 90 >ref|XP_002534237.1| conserved hypothetical protein [Ricinus communis] gi|223525657|gb|EEF28144.1| conserved hypothetical protein [Ricinus communis] Length = 106 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/61 (47%), Positives = 38/61 (62%), Gaps = 4/61 (6%) Frame = +1 Query: 106 ASRPLGSKL-EDYTTFKPKVIKPKHGF---GVEGCMPKGRRHSSAPSRYINYEPLDSLTC 273 A+RPL SK ++ F+PK + GF VE C+PKG +SAPSRYINY+ L + C Sbjct: 38 AARPLPSKSSKELVAFRPKTTHGRKGFRGRDVENCLPKGFHRTSAPSRYINYDTLGATMC 97 Query: 274 S 276 S Sbjct: 98 S 98