BLASTX nr result
ID: Salvia21_contig00037272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00037272 (424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB70511.1| Myb [Nicotiana tabacum] 55 8e-06 >dbj|BAB70511.1| Myb [Nicotiana tabacum] Length = 1042 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = +1 Query: 307 METDRTGNNNPSDVAKNGLQRARPLHGRTSGPTRRSTKG 423 ME+DR + PSD + LQR RPLHGRTSGPTRRSTKG Sbjct: 1 MESDRI--STPSDGTSSSLQRVRPLHGRTSGPTRRSTKG 37