BLASTX nr result
ID: Salvia21_contig00037020
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00037020 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328899.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_004166159.1| PREDICTED: probable sucrose-phosphate syntha... 57 2e-06 ref|XP_004138938.1| PREDICTED: probable sucrose-phosphate syntha... 57 2e-06 gb|AFD64638.1| sucrose-phosphate synthase B [Solanum lycopersicum] 55 4e-06 ref|XP_002518055.1| sucrose phosphate syntase, putative [Ricinus... 55 6e-06 >ref|XP_002328899.1| predicted protein [Populus trichocarpa] gi|222839329|gb|EEE77666.1| predicted protein [Populus trichocarpa] Length = 1069 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 2/35 (5%) Frame = +2 Query: 170 MAGNEWINGYLEAILDS--GASAIEDHKPAPAVSV 268 MAGNEWINGYLEAILDS GA AIE+HKPAP++++ Sbjct: 1 MAGNEWINGYLEAILDSGGGAGAIEEHKPAPSMNL 35 >ref|XP_004166159.1| PREDICTED: probable sucrose-phosphate synthase 2-like [Cucumis sativus] Length = 1071 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +2 Query: 170 MAGNEWINGYLEAILDSGASAIEDHKPAPAVSVS 271 MAGNEWINGYLEAILD+GA+AIE+ KPA A + + Sbjct: 1 MAGNEWINGYLEAILDTGATAIEEQKPASAAAAA 34 >ref|XP_004138938.1| PREDICTED: probable sucrose-phosphate synthase 2-like [Cucumis sativus] Length = 1067 Score = 56.6 bits (135), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +2 Query: 170 MAGNEWINGYLEAILDSGASAIEDHKPAPAVSVS 271 MAGNEWINGYLEAILD+GA+AIE+ KPA A + + Sbjct: 1 MAGNEWINGYLEAILDTGATAIEEQKPASAAAAA 34 >gb|AFD64638.1| sucrose-phosphate synthase B [Solanum lycopersicum] Length = 1064 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +2 Query: 170 MAGNEWINGYLEAILDSGASAIEDHKPAPAVSVS 271 MAGNEWINGYLEAIL SGASAIED KP+ + S Sbjct: 1 MAGNEWINGYLEAILSSGASAIEDKKPSSTTTSS 34 >ref|XP_002518055.1| sucrose phosphate syntase, putative [Ricinus communis] gi|223542651|gb|EEF44188.1| sucrose phosphate syntase, putative [Ricinus communis] Length = 1064 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 170 MAGNEWINGYLEAILDSGASAIEDHKPAPAVSV 268 MAGNEWINGYLEAILDSGA AIE+ KP V + Sbjct: 1 MAGNEWINGYLEAILDSGAGAIEEQKPVQPVDL 33