BLASTX nr result
ID: Salvia21_contig00036450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00036450 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004173289.1| PREDICTED: LOW QUALITY PROTEIN: auxin transp... 145 3e-33 ref|XP_004144920.1| PREDICTED: auxin transporter-like protein 5-... 145 3e-33 ref|NP_179701.1| auxin transporter-like protein 2 [Arabidopsis t... 145 3e-33 emb|CCF23028.1| auxin influx carrier protein [Mangifera indica] ... 145 3e-33 emb|CCF23027.1| auxin influx carrier protein [Mangifera indica] ... 145 3e-33 >ref|XP_004173289.1| PREDICTED: LOW QUALITY PROTEIN: auxin transporter-like protein 5-like, partial [Cucumis sativus] Length = 409 Score = 145 bits (367), Expect = 3e-33 Identities = 67/67 (100%), Positives = 67/67 (100%) Frame = +3 Query: 3 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA 182 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA Sbjct: 35 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA 94 Query: 183 TTVFIPS 203 TTVFIPS Sbjct: 95 TTVFIPS 101 >ref|XP_004144920.1| PREDICTED: auxin transporter-like protein 5-like [Cucumis sativus] Length = 407 Score = 145 bits (367), Expect = 3e-33 Identities = 67/67 (100%), Positives = 67/67 (100%) Frame = +3 Query: 3 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA 182 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA Sbjct: 33 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA 92 Query: 183 TTVFIPS 203 TTVFIPS Sbjct: 93 TTVFIPS 99 >ref|NP_179701.1| auxin transporter-like protein 2 [Arabidopsis thaliana] gi|75265396|sp|Q9S836.1|LAX2_ARATH RecName: Full=Auxin transporter-like protein 2; AltName: Full=AUX1-like protein 2 gi|4803938|gb|AAD29811.1| AUX1-like amino acid permease [Arabidopsis thaliana] gi|5139337|emb|CAB45643.1| putative AUX1-like permease [Arabidopsis thaliana] gi|15451208|gb|AAK96875.1| AUX1-like amino acid permease [Arabidopsis thaliana] gi|22136072|gb|AAM91114.1| AUX1-like amino acid permease [Arabidopsis thaliana] gi|330252022|gb|AEC07116.1| auxin transporter-like protein 2 [Arabidopsis thaliana] Length = 483 Score = 145 bits (367), Expect = 3e-33 Identities = 67/67 (100%), Positives = 67/67 (100%) Frame = +3 Query: 3 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA 182 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA Sbjct: 117 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA 176 Query: 183 TTVFIPS 203 TTVFIPS Sbjct: 177 TTVFIPS 183 >emb|CCF23028.1| auxin influx carrier protein [Mangifera indica] gi|381280187|gb|AFG18188.1| auxin influx carrier component [Mangifera indica] Length = 494 Score = 145 bits (367), Expect = 3e-33 Identities = 67/67 (100%), Positives = 67/67 (100%) Frame = +3 Query: 3 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA 182 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA Sbjct: 116 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA 175 Query: 183 TTVFIPS 203 TTVFIPS Sbjct: 176 TTVFIPS 182 >emb|CCF23027.1| auxin influx carrier protein [Mangifera indica] gi|381280185|gb|AFG18187.1| auxin influx carrier component [Mangifera indica] Length = 493 Score = 145 bits (367), Expect = 3e-33 Identities = 67/67 (100%), Positives = 67/67 (100%) Frame = +3 Query: 3 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA 182 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA Sbjct: 116 FEVLDGLLGKHWRNVGLAFNCTFLLFGSVIQLIACASNIYYINDNLDKRTWTYIFGACCA 175 Query: 183 TTVFIPS 203 TTVFIPS Sbjct: 176 TTVFIPS 182