BLASTX nr result
ID: Salvia21_contig00036400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00036400 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519429.1| Uracil permease, putative [Ricinus communis]... 55 4e-06 >ref|XP_002519429.1| Uracil permease, putative [Ricinus communis] gi|223541292|gb|EEF42843.1| Uracil permease, putative [Ricinus communis] Length = 566 Score = 55.5 bits (132), Expect = 4e-06 Identities = 42/96 (43%), Positives = 47/96 (48%), Gaps = 14/96 (14%) Frame = +3 Query: 147 MVSKCLSFSLHLHQN----------HIFSNPKPNYHLKKSLIFPTN----LTKKHPTLPK 284 MVSKC F+LHLH H SNP L FP L KK TL Sbjct: 1 MVSKC--FNLHLHLTTAKPKSSRLPHFPSNPLTPTVTTTKLNFPYGQNQFLPKKRCTLLN 58 Query: 285 RCYPYPLMSSNHSQTISQFDEWEPDPTLTNDDLKPT 392 + M S+ S+FDE+EPDPTLTNDDLKPT Sbjct: 59 THH----MGSSQYYKSSEFDEFEPDPTLTNDDLKPT 90