BLASTX nr result
ID: Salvia21_contig00036160
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00036160 (476 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535497.1| conserved hypothetical protein [Ricinus comm... 55 2e-07 >ref|XP_002535497.1| conserved hypothetical protein [Ricinus communis] gi|223522895|gb|EEF26886.1| conserved hypothetical protein [Ricinus communis] Length = 110 Score = 55.5 bits (132), Expect(2) = 2e-07 Identities = 31/51 (60%), Positives = 34/51 (66%) Frame = +1 Query: 13 NLRSYVSILDSSIERKVTPRGSVLWGNPTPLVPTDSIRKEALHLGINNTKP 165 N S SI+DSSIERKV NPTPLVP I++EAL LGINNTKP Sbjct: 56 NAASDASIVDSSIERKV---------NPTPLVPIGGIKEEALRLGINNTKP 97 Score = 24.3 bits (51), Expect(2) = 2e-07 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 149 STTQNLVRNDPFPYWARD 202 + T+ L+ PFPYW RD Sbjct: 93 NNTKPLLEIFPFPYWDRD 110