BLASTX nr result
ID: Salvia21_contig00036143
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00036143 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534909.1| PREDICTED: LOW QUALITY PROTEIN: putative dis... 60 2e-07 ref|NP_001237924.1| CC-NBS-LRR class disease resistance protein ... 56 3e-06 >ref|XP_003534909.1| PREDICTED: LOW QUALITY PROTEIN: putative disease resistance protein At1g50180-like [Glycine max] Length = 905 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +1 Query: 4 NLTEWKVEKGAMPILSELEIRHCPKLGKVQDELRSITNLEELEI 135 NL EWK++KGAMP LS+LEI +C KL KV D LR +T L++LEI Sbjct: 808 NLEEWKLDKGAMPSLSKLEIANCTKLEKVPDGLRFVTTLQDLEI 851 >ref|NP_001237924.1| CC-NBS-LRR class disease resistance protein [Glycine max] gi|212717123|gb|ACJ37403.1| CC-NBS-LRR class disease resistance protein [Glycine max] Length = 979 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +1 Query: 1 PNLTEWKVEKGAMPILSELEIRHCPKLGKVQDELRSITNLEELEI 135 PNL EWK+ KGAMP L +LEI +C KL +V D LR + L++LEI Sbjct: 842 PNLEEWKLGKGAMPSLRKLEIANCTKLERVPDGLRFVATLQDLEI 886