BLASTX nr result
ID: Salvia21_contig00036050
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00036050 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303465.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 gb|AAD01804.1| lipase [Dianthus caryophyllus] 57 1e-06 ref|XP_002518706.1| triacylglycerol lipase, putative [Ricinus co... 56 3e-06 ref|XP_002522219.1| hypothetical protein RCOM_1733320 [Ricinus c... 56 3e-06 ref|XP_002881867.1| hypothetical protein ARALYDRAFT_483364 [Arab... 55 5e-06 >ref|XP_002303465.1| predicted protein [Populus trichocarpa] gi|222840897|gb|EEE78444.1| predicted protein [Populus trichocarpa] Length = 411 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -3 Query: 326 DECKIPGSWWVAENRGMMLNEEGEWVLKPPLDDDCPAVPE 207 DEC +PG WWV +N+GM+ NE+GEWVL PP ++D P VPE Sbjct: 372 DECLVPGIWWVEKNKGMVRNEDGEWVLAPPDEEDLP-VPE 410 >gb|AAD01804.1| lipase [Dianthus caryophyllus] Length = 447 Score = 57.4 bits (137), Expect = 1e-06 Identities = 20/36 (55%), Positives = 29/36 (80%) Frame = -3 Query: 326 DECKIPGSWWVAENRGMMLNEEGEWVLKPPLDDDCP 219 +EC +P +WWV +N+GM+LN++GEWVL PP +D P Sbjct: 409 EECLVPPAWWVVQNKGMVLNKDGEWVLAPPEEDPTP 444 >ref|XP_002518706.1| triacylglycerol lipase, putative [Ricinus communis] gi|223542087|gb|EEF43631.1| triacylglycerol lipase, putative [Ricinus communis] Length = 417 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = -3 Query: 326 DECKIPGSWWVAENRGMMLNEEGEWVLKPPLDDDCPAVPE 207 DEC +PGSWWV +NRGM+ ++GEW L P ++D P VPE Sbjct: 378 DECLVPGSWWVEKNRGMVRGDDGEWTLAPADEEDRP-VPE 416 >ref|XP_002522219.1| hypothetical protein RCOM_1733320 [Ricinus communis] gi|223538590|gb|EEF40194.1| hypothetical protein RCOM_1733320 [Ricinus communis] Length = 176 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/40 (57%), Positives = 30/40 (75%) Frame = -3 Query: 326 DECKIPGSWWVAENRGMMLNEEGEWVLKPPLDDDCPAVPE 207 DEC +PGSWWV +NRGM+ ++GEW L P ++D P VPE Sbjct: 137 DECLVPGSWWVEKNRGMVRGDDGEWTLAPADEEDQP-VPE 175 >ref|XP_002881867.1| hypothetical protein ARALYDRAFT_483364 [Arabidopsis lyrata subsp. lyrata] gi|297327706|gb|EFH58126.1| hypothetical protein ARALYDRAFT_483364 [Arabidopsis lyrata subsp. lyrata] Length = 411 Score = 55.5 bits (132), Expect = 5e-06 Identities = 20/36 (55%), Positives = 28/36 (77%) Frame = -3 Query: 326 DECKIPGSWWVAENRGMMLNEEGEWVLKPPLDDDCP 219 DEC +PGSWWV +N+G++ NE+GEWVL P ++ P Sbjct: 374 DECLVPGSWWVEKNKGLIKNEDGEWVLAPVEEEPVP 409