BLASTX nr result
ID: Salvia21_contig00035847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00035847 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003621695.1| ATP synthase subunit beta [Medicago truncatu... 88 8e-28 ref|XP_003599585.1| ATP synthase subunit beta [Medicago truncatu... 88 8e-28 ref|YP_007507118.1| ATP synthase CF1 beta subunit (chloroplast) ... 127 1e-27 emb|CAB89984.1| ATP synthase beta subunit [Rubia tinctorum] 124 6e-27 ref|YP_001837367.1| ATP synthase CF1 beta subunit [Guizotia abys... 124 8e-27 >ref|XP_003621695.1| ATP synthase subunit beta [Medicago truncatula] gi|355496710|gb|AES77913.1| ATP synthase subunit beta [Medicago truncatula] Length = 618 Score = 88.2 bits (217), Expect(2) = 8e-28 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +2 Query: 2 FFVAEVFTGSPGKYVGLAETIKGFQLILSGELDALPEQAFYLVGNIDEAT 151 FFVAEVFTGSPGKYVGLAETI+GF+LILSGELD+LPEQAFYLV I E T Sbjct: 435 FFVAEVFTGSPGKYVGLAETIRGFKLILSGELDSLPEQAFYLVEQIQEMT 484 Score = 60.5 bits (145), Expect(2) = 8e-28 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 178 EQFEEMTLNLCVLTPNRIVWDSEVKEIILST 270 EQ +EMTLNLCVLTPNR VWDSEVKEIILST Sbjct: 478 EQIQEMTLNLCVLTPNRTVWDSEVKEIILST 508 >ref|XP_003599585.1| ATP synthase subunit beta [Medicago truncatula] gi|355488633|gb|AES69836.1| ATP synthase subunit beta [Medicago truncatula] Length = 618 Score = 88.2 bits (217), Expect(2) = 8e-28 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +2 Query: 2 FFVAEVFTGSPGKYVGLAETIKGFQLILSGELDALPEQAFYLVGNIDEAT 151 FFVAEVFTGSPGKYVGLAETI+GF+LILSGELD+LPEQAFYLV I E T Sbjct: 435 FFVAEVFTGSPGKYVGLAETIRGFKLILSGELDSLPEQAFYLVEQIQEMT 484 Score = 60.5 bits (145), Expect(2) = 8e-28 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 178 EQFEEMTLNLCVLTPNRIVWDSEVKEIILST 270 EQ +EMTLNLCVLTPNR VWDSEVKEIILST Sbjct: 478 EQIQEMTLNLCVLTPNRTVWDSEVKEIILST 508 >ref|YP_007507118.1| ATP synthase CF1 beta subunit (chloroplast) [Salvia miltiorrhiza] gi|401879749|gb|AFQ30936.1| ATP synthase CF1 beta subunit (chloroplast) [Salvia miltiorrhiza] Length = 498 Score = 127 bits (318), Expect = 1e-27 Identities = 64/64 (100%), Positives = 64/64 (100%) Frame = +2 Query: 2 FFVAEVFTGSPGKYVGLAETIKGFQLILSGELDALPEQAFYLVGNIDEATAKAINLEMES 181 FFVAEVFTGSPGKYVGLAETIKGFQLILSGELDALPEQAFYLVGNIDEATAKAINLEMES Sbjct: 435 FFVAEVFTGSPGKYVGLAETIKGFQLILSGELDALPEQAFYLVGNIDEATAKAINLEMES 494 Query: 182 NLKK 193 NLKK Sbjct: 495 NLKK 498 >emb|CAB89984.1| ATP synthase beta subunit [Rubia tinctorum] Length = 489 Score = 124 bits (312), Expect = 6e-27 Identities = 62/64 (96%), Positives = 64/64 (100%) Frame = +2 Query: 2 FFVAEVFTGSPGKYVGLAETIKGFQLILSGELDALPEQAFYLVGNIDEATAKAINLEMES 181 FFVAEVFTGSPGKYVGLAETI+GFQLILSGELDALPEQAFYLVGNIDEATAKA+NLEMES Sbjct: 426 FFVAEVFTGSPGKYVGLAETIRGFQLILSGELDALPEQAFYLVGNIDEATAKAMNLEMES 485 Query: 182 NLKK 193 NLKK Sbjct: 486 NLKK 489 >ref|YP_001837367.1| ATP synthase CF1 beta subunit [Guizotia abyssinica] gi|179366263|gb|ACB86534.1| ATP synthase CF1 beta subunit [Guizotia abyssinica] Length = 498 Score = 124 bits (311), Expect = 8e-27 Identities = 62/64 (96%), Positives = 63/64 (98%) Frame = +2 Query: 2 FFVAEVFTGSPGKYVGLAETIKGFQLILSGELDALPEQAFYLVGNIDEATAKAINLEMES 181 FFVAEVFTGSPGKYVGLAETI+GFQLILSGELD LPEQAFYLVGNIDEATAKAINLEMES Sbjct: 435 FFVAEVFTGSPGKYVGLAETIRGFQLILSGELDGLPEQAFYLVGNIDEATAKAINLEMES 494 Query: 182 NLKK 193 NLKK Sbjct: 495 NLKK 498