BLASTX nr result
ID: Salvia21_contig00035634
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00035634 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61340.1| hypothetical protein VITISV_007301 [Vitis vinifera] 49 2e-07 emb|CAN75363.1| hypothetical protein VITISV_026292 [Vitis vinifera] 45 2e-06 emb|CAN73532.1| hypothetical protein VITISV_012827 [Vitis vinifera] 44 5e-06 >emb|CAN61340.1| hypothetical protein VITISV_007301 [Vitis vinifera] Length = 973 Score = 48.5 bits (114), Expect(2) = 2e-07 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = -3 Query: 126 EQNGTWELSAKVMRCKPISRKWVYKLMT*LDGSIKQHKA*LV 1 +QN TWEL K +PIS KWVYK+ DGSI++HKA LV Sbjct: 499 KQNQTWELVPKPRDVEPISCKWVYKIKRRTDGSIERHKARLV 540 Score = 31.6 bits (70), Expect(2) = 2e-07 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 202 LPLRRTGSQRTPNPEYVNVAISGIRGAK 119 +PLRR+ + PNP+Y NVAI AK Sbjct: 446 IPLRRSARTKKPNPKYANVAIVEDANAK 473 >emb|CAN75363.1| hypothetical protein VITISV_026292 [Vitis vinifera] Length = 1161 Score = 45.1 bits (105), Expect(2) = 2e-06 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = -3 Query: 126 EQNGTWELSAKVMRCKPISRKWVYKLMT*LDGSIKQHKA*LV 1 ++N TWEL K +PIS KWVYK+ DG I++HKA LV Sbjct: 754 KRNQTWELVPKXRDVEPISCKWVYKIKRRTDGLIERHKARLV 795 Score = 31.6 bits (70), Expect(2) = 2e-06 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -2 Query: 202 LPLRRTGSQRTPNPEYVNVAISGIRGAK 119 +PLRR+ + PNP+Y NVAI AK Sbjct: 701 IPLRRSARTKKPNPKYANVAIVEDANAK 728 >emb|CAN73532.1| hypothetical protein VITISV_012827 [Vitis vinifera] Length = 1194 Score = 43.9 bits (102), Expect(2) = 5e-06 Identities = 22/42 (52%), Positives = 27/42 (64%) Frame = -3 Query: 126 EQNGTWELSAKVMRCKPISRKWVYKLMT*LDGSIKQHKA*LV 1 ++N TWEL K +PIS KWVYK+ GSI+ HKA LV Sbjct: 822 KRNQTWELVPKPRDVEPISCKWVYKIKRRTXGSIEMHKARLV 863 Score = 31.2 bits (69), Expect(2) = 5e-06 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -2 Query: 202 LPLRRTGSQRTPNPEYVNVAI 140 +PLRR+ + PNP+Y NVAI Sbjct: 769 IPLRRSARTKKPNPKYANVAI 789