BLASTX nr result
ID: Salvia21_contig00035625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00035625 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004259428.1| ribonuclease H1 [Bacteroides salanitronis DS... 69 5e-10 ref|ZP_09601083.1| double-stranded RNA/RNA-DNA hybrid binding pr... 68 9e-10 ref|ZP_08457507.1| putative ribonuclease H1 [Bacteroides coprosu... 65 4e-09 ref|ZP_01159519.1| hypothetical ribonuclease HI [Photobacterium ... 65 4e-09 ref|ZP_09483173.1| ribonuclease H1 [Anaerophaga sp. HS1] 65 8e-09 >ref|YP_004259428.1| ribonuclease H1 [Bacteroides salanitronis DSM 18170] gi|324319064|gb|ADY36955.1| putative ribonuclease H1 [Bacteroides salanitronis DSM 18170] Length = 208 Score = 68.6 bits (166), Expect = 5e-10 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = +3 Query: 39 YYVVWVGKEPGIYDNWTDCRNQIHQFKGAVYKKYPSLEEAKEAICNQPPH 188 +YVVW G EPG+YD+WTDC+ QI +KGA+YK + + EEA++A+ P H Sbjct: 6 FYVVWKGVEPGVYDSWTDCQLQIKGYKGALYKSFDTREEAEKALVTPPHH 55 >ref|ZP_09601083.1| double-stranded RNA/RNA-DNA hybrid binding protein [Bacillus sp. 1NLA3E] gi|372451813|gb|EHP25287.1| double-stranded RNA/RNA-DNA hybrid binding protein [Bacillus sp. 1NLA3E] Length = 209 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/73 (42%), Positives = 44/73 (60%) Frame = +3 Query: 39 YYVVWVGKEPGIYDNWTDCRNQIHQFKGAVYKKYPSLEEAKEAICNQPPHAPWAEPPSRW 218 YYVVW G+ G++ +W DC Q F+GA +K +PSLEEA +A N P+ + S+ Sbjct: 7 YYVVWAGRNTGVFRSWADCEKQTKGFQGASFKSFPSLEEANQAYSNGKPNYSF----SKV 62 Query: 219 KQATKHEGASSTS 257 K ATK G+S + Sbjct: 63 KNATKKSGSSEVT 75 >ref|ZP_08457507.1| putative ribonuclease H1 [Bacteroides coprosuis DSM 18011] gi|332740043|gb|EGJ70525.1| putative ribonuclease H1 [Bacteroides coprosuis DSM 18011] Length = 218 Score = 65.5 bits (158), Expect = 4e-09 Identities = 26/48 (54%), Positives = 37/48 (77%) Frame = +3 Query: 39 YYVVWVGKEPGIYDNWTDCRNQIHQFKGAVYKKYPSLEEAKEAICNQP 182 YYVVW G PGIY +WTDC+ QI+ ++GA+YK +P+LE+A+ A + P Sbjct: 13 YYVVWKGVNPGIYTSWTDCQLQINGYEGALYKSFPTLEKAEYAYASSP 60 >ref|ZP_01159519.1| hypothetical ribonuclease HI [Photobacterium sp. SKA34] gi|89051190|gb|EAR56646.1| hypothetical ribonuclease HI [Photobacterium sp. SKA34] Length = 255 Score = 65.5 bits (158), Expect = 4e-09 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +3 Query: 39 YYVVWVGKEPGIYDNWTDCRNQIHQFKGAVYKKYPSLEEAKEA 167 +YVVW G+EPGIY +WT C+ Q+ +F GA YK +PS EEAK A Sbjct: 5 FYVVWQGREPGIYTDWTSCKQQVDKFTGAKYKSFPSQEEAKAA 47 >ref|ZP_09483173.1| ribonuclease H1 [Anaerophaga sp. HS1] Length = 208 Score = 64.7 bits (156), Expect = 8e-09 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = +3 Query: 39 YYVVWVGKEPGIYDNWTDCRNQIHQFKGAVYKKYPSLEEAKEA 167 YYV+WVG + GI D+W +C +IH FKGA YK Y SLEEAK A Sbjct: 6 YYVIWVGHKTGIVDSWEECNKRIHGFKGARYKSYKSLEEAKRA 48