BLASTX nr result
ID: Salvia21_contig00035548
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00035548 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518741.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 ref|XP_002298728.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_004140806.1| PREDICTED: uncharacterized protein LOC101203... 57 1e-06 >ref|XP_002518741.1| conserved hypothetical protein [Ricinus communis] gi|223542122|gb|EEF43666.1| conserved hypothetical protein [Ricinus communis] Length = 445 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -3 Query: 331 RFGVSEAVSKFCVKQICCVLCTNYRFWVGFPGHAELKSQRNA 206 RFGV+E+ ++FC KQ+C VLCTN+RFWV FP EL+S NA Sbjct: 169 RFGVTESAARFCAKQLCRVLCTNFRFWVSFPSPVELQSVSNA 210 >ref|XP_002298728.1| predicted protein [Populus trichocarpa] gi|222845986|gb|EEE83533.1| predicted protein [Populus trichocarpa] Length = 433 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -3 Query: 331 RFGVSEAVSKFCVKQICCVLCTNYRFWVGFPGHAELK 221 RFGV+E+V++FC KQ+C VLCTN+RFW+ FP EL+ Sbjct: 161 RFGVTESVTRFCAKQLCRVLCTNFRFWIAFPTSTELQ 197 >ref|XP_004140806.1| PREDICTED: uncharacterized protein LOC101203312 [Cucumis sativus] gi|449501700|ref|XP_004161442.1| PREDICTED: uncharacterized LOC101203312 [Cucumis sativus] Length = 386 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -3 Query: 331 RFGVSEAVSKFCVKQICCVLCTNYRFWVGFPGHAELKSQRNA 206 +FGVSE+V++FC KQ+C VLCTN+RFWV FP EL+ +A Sbjct: 159 QFGVSESVARFCSKQLCRVLCTNFRFWVEFPCPNELELTSSA 200