BLASTX nr result
ID: Salvia21_contig00035485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00035485 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269533.2| PREDICTED: pentatricopeptide repeat-containi... 60 1e-07 emb|CBI31095.3| unnamed protein product [Vitis vinifera] 60 1e-07 ref|XP_003610950.1| Pentatricopeptide repeat-containing protein ... 55 4e-06 >ref|XP_002269533.2| PREDICTED: pentatricopeptide repeat-containing protein At4g20770-like [Vitis vinifera] Length = 847 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 334 NSAPYSLLANMYSSLDRWVDVKDVRDIMGRQQVSKEAGYSWV 209 NSAPY LLAN+YSSL RW D K VR++M QV K+ GYSW+ Sbjct: 722 NSAPYVLLANIYSSLGRWDDAKAVRELMSYNQVVKDPGYSWI 763 >emb|CBI31095.3| unnamed protein product [Vitis vinifera] Length = 768 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 334 NSAPYSLLANMYSSLDRWVDVKDVRDIMGRQQVSKEAGYSWV 209 NSAPY LLAN+YSSL RW D K VR++M QV K+ GYSW+ Sbjct: 693 NSAPYVLLANIYSSLGRWDDAKAVRELMSYNQVVKDPGYSWI 734 >ref|XP_003610950.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355512285|gb|AES93908.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 831 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/40 (62%), Positives = 30/40 (75%) Frame = -1 Query: 334 NSAPYSLLANMYSSLDRWVDVKDVRDIMGRQQVSKEAGYS 215 NSAPY LLANMYSS+ RW D + VRD+M Q+ K+ GYS Sbjct: 721 NSAPYVLLANMYSSMGRWDDAQVVRDLMSDNQIHKDPGYS 760