BLASTX nr result
ID: Salvia21_contig00035257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00035257 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524009.1| conserved hypothetical protein [Ricinus comm... 74 9e-12 ref|XP_002333676.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 emb|CAN60246.1| hypothetical protein VITISV_015672 [Vitis vinifera] 68 7e-10 ref|XP_003626844.1| hypothetical protein MTR_8g011160 [Medicago ... 67 1e-09 ref|XP_004138999.1| PREDICTED: uncharacterized protein LOC101203... 67 2e-09 >ref|XP_002524009.1| conserved hypothetical protein [Ricinus communis] gi|223536736|gb|EEF38377.1| conserved hypothetical protein [Ricinus communis] Length = 207 Score = 74.3 bits (181), Expect = 9e-12 Identities = 31/62 (50%), Positives = 45/62 (72%), Gaps = 1/62 (1%) Frame = +3 Query: 42 DKEGDVRVPLVFAVFFLCVTTGGVFLVIYVFVP-SISRPWYPCAALFLIGAPWIFWFITY 218 +++GD R+ LV FFLC+ +GGVFL +Y+F+P + ++ WYP A L L+ PW WF+TY Sbjct: 15 NRKGDPRIYLVTGFFFLCIISGGVFLGLYIFLPENNTQLWYPTAGLVLVAIPWAVWFLTY 74 Query: 219 LY 224 LY Sbjct: 75 LY 76 >ref|XP_002333676.1| predicted protein [Populus trichocarpa] gi|224146118|ref|XP_002325886.1| predicted protein [Populus trichocarpa] gi|222837981|gb|EEE76346.1| predicted protein [Populus trichocarpa] gi|222862761|gb|EEF00268.1| predicted protein [Populus trichocarpa] Length = 168 Score = 69.3 bits (168), Expect = 3e-10 Identities = 26/66 (39%), Positives = 45/66 (68%), Gaps = 1/66 (1%) Frame = +3 Query: 42 DKEGDVRVPLVFAVFFLCVTTGGVFLVIYVFVP-SISRPWYPCAALFLIGAPWIFWFITY 218 +++GD+R+ + A+F C+ +GG L +Y+F+P S + WY A + L+ APW FWF+TY Sbjct: 3 ERKGDLRIYVAVALFSACLVSGGALLALYMFLPISNVKSWYAIAGMILVAAPWAFWFLTY 62 Query: 219 LYTVMK 236 +Y ++ Sbjct: 63 IYRCLR 68 >emb|CAN60246.1| hypothetical protein VITISV_015672 [Vitis vinifera] Length = 144 Score = 68.2 bits (165), Expect = 7e-10 Identities = 26/65 (40%), Positives = 37/65 (56%), Gaps = 1/65 (1%) Frame = +3 Query: 45 KEGDVRVPLVFAVFFLCVTTGGVFLVIYVFVPSISRP-WYPCAALFLIGAPWIFWFITYL 221 ++ D RV L+ FF+C+ GG L +Y+F+P WYP L+G PW+FW +TY Sbjct: 4 RKDDFRVHLITGTFFVCIVAGGTCLCLYIFLPGAQHTSWYPIVGFILVGIPWLFWLLTYC 63 Query: 222 YTVMK 236 Y K Sbjct: 64 YRCFK 68 >ref|XP_003626844.1| hypothetical protein MTR_8g011160 [Medicago truncatula] gi|355520866|gb|AET01320.1| hypothetical protein MTR_8g011160 [Medicago truncatula] Length = 171 Score = 67.4 bits (163), Expect = 1e-09 Identities = 27/66 (40%), Positives = 43/66 (65%), Gaps = 1/66 (1%) Frame = +3 Query: 42 DKEGDVRVPLVFAVFFLCVTTGGVFLVIYVFVP-SISRPWYPCAALFLIGAPWIFWFITY 218 D++GDVR+ ++ FF C GG+FL +Y+F+P S S PWY A + L+ PW+ WF+ Sbjct: 3 DRKGDVRIYVISCFFFACTIGGGIFLCMYIFLPDSESLPWYLFAGMALVAIPWLSWFLIL 62 Query: 219 LYTVMK 236 +Y ++ Sbjct: 63 IYRCIR 68 >ref|XP_004138999.1| PREDICTED: uncharacterized protein LOC101203715 [Cucumis sativus] gi|449527450|ref|XP_004170724.1| PREDICTED: uncharacterized LOC101203715 [Cucumis sativus] Length = 174 Score = 66.6 bits (161), Expect = 2e-09 Identities = 25/66 (37%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = +3 Query: 42 DKEGDVRVPLVFAVFFLCVTTGGVFLVIYVFVP-SISRPWYPCAALFLIGAPWIFWFITY 218 +++GD R+ ++ + FLC+ GG L +Y+F+P S + WYP + L+ PWIFW Y Sbjct: 17 ERKGDARIVIISGLIFLCIILGGFLLCLYLFLPESQTSDWYPTIGIVLVSTPWIFWLSVY 76 Query: 219 LYTVMK 236 +Y +K Sbjct: 77 IYHCLK 82