BLASTX nr result
ID: Salvia21_contig00035200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00035200 (371 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525577.1| conserved hypothetical protein [Ricinus comm... 93 2e-17 ref|XP_002264033.2| PREDICTED: uncharacterized protein LOC100263... 91 1e-16 emb|CBI40627.3| unnamed protein product [Vitis vinifera] 91 1e-16 ref|XP_002266876.2| PREDICTED: uncharacterized protein LOC100249... 91 1e-16 emb|CBI25812.3| unnamed protein product [Vitis vinifera] 91 1e-16 >ref|XP_002525577.1| conserved hypothetical protein [Ricinus communis] gi|223535156|gb|EEF36836.1| conserved hypothetical protein [Ricinus communis] Length = 237 Score = 93.2 bits (230), Expect = 2e-17 Identities = 42/52 (80%), Positives = 47/52 (90%) Frame = -1 Query: 371 GALALAPFVDRGLSWFTIKMGFESQGKAFMAIAGLCFGLAFLMFVIVTLLWA 216 GALALAPFVDRGLSWFT+K FESQGKAFMAI G C GLAF++F++VTLLWA Sbjct: 186 GALALAPFVDRGLSWFTLKFKFESQGKAFMAIVGFCLGLAFILFLVVTLLWA 237 >ref|XP_002264033.2| PREDICTED: uncharacterized protein LOC100263253 [Vitis vinifera] Length = 125 Score = 90.9 bits (224), Expect = 1e-16 Identities = 42/52 (80%), Positives = 45/52 (86%) Frame = -1 Query: 371 GALALAPFVDRGLSWFTIKMGFESQGKAFMAIAGLCFGLAFLMFVIVTLLWA 216 GALALAP VDRGLSWFT+K FESQGKAFMAI G CFGLA ++F IVTLLWA Sbjct: 74 GALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 125 >emb|CBI40627.3| unnamed protein product [Vitis vinifera] Length = 82 Score = 90.9 bits (224), Expect = 1e-16 Identities = 42/52 (80%), Positives = 45/52 (86%) Frame = -1 Query: 371 GALALAPFVDRGLSWFTIKMGFESQGKAFMAIAGLCFGLAFLMFVIVTLLWA 216 GALALAP VDRGLSWFT+K FESQGKAFMAI G CFGLA ++F IVTLLWA Sbjct: 31 GALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 82 >ref|XP_002266876.2| PREDICTED: uncharacterized protein LOC100249912 [Vitis vinifera] gi|298205097|emb|CBI40618.3| unnamed protein product [Vitis vinifera] Length = 153 Score = 90.9 bits (224), Expect = 1e-16 Identities = 42/52 (80%), Positives = 45/52 (86%) Frame = -1 Query: 371 GALALAPFVDRGLSWFTIKMGFESQGKAFMAIAGLCFGLAFLMFVIVTLLWA 216 GALALAP VDRGLSWFT+K FESQGKAFMAI G CFGLA ++F IVTLLWA Sbjct: 102 GALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 153 >emb|CBI25812.3| unnamed protein product [Vitis vinifera] Length = 213 Score = 90.9 bits (224), Expect = 1e-16 Identities = 42/52 (80%), Positives = 45/52 (86%) Frame = -1 Query: 371 GALALAPFVDRGLSWFTIKMGFESQGKAFMAIAGLCFGLAFLMFVIVTLLWA 216 GALALAP VDRGLSWFT+K FESQGKAFMAI G CFGLA ++F IVTLLWA Sbjct: 162 GALALAPIVDRGLSWFTVKFKFESQGKAFMAIVGFCFGLALILFFIVTLLWA 213