BLASTX nr result
ID: Salvia21_contig00034950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00034950 (216 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529686.1| Minor histocompatibility antigen H13, putati... 55 6e-06 >ref|XP_002529686.1| Minor histocompatibility antigen H13, putative [Ricinus communis] gi|223530834|gb|EEF32697.1| Minor histocompatibility antigen H13, putative [Ricinus communis] Length = 535 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 123 VARGNNSGGESIPMLLRFPKLSDPYYGYNMI 215 VARG+NSGGESIPMLLRFP+ +DP+ GY+MI Sbjct: 399 VARGDNSGGESIPMLLRFPRFADPWGGYDMI 429