BLASTX nr result
ID: Salvia21_contig00034928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00034928 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN09154.1| RNA-directed DNA polymerase (Reverse transcriptas... 102 3e-20 gb|ABD28670.2| RNA-directed DNA polymerase (Reverse transcriptas... 100 1e-19 gb|ABE87589.2| RNA-directed DNA polymerase (Reverse transcriptas... 88 6e-16 emb|CAN60702.1| hypothetical protein VITISV_015869 [Vitis vinifera] 81 1e-13 emb|CAN74986.1| hypothetical protein VITISV_008771 [Vitis vinifera] 80 1e-13 >gb|ABN09154.1| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 528 Score = 102 bits (254), Expect = 3e-20 Identities = 50/81 (61%), Positives = 58/81 (71%) Frame = -3 Query: 251 FLLFVLQQFGFPNIFCSWIKTILSSARISIRFNGALYGYFECGRGVRQGDPLSPILFALA 72 FLL VL+QFGF FC+WI IL SA++SI NG+ GYF C RGVRQGDPLSP+LF LA Sbjct: 274 FLLKVLKQFGFSETFCNWIDAILQSAKLSICINGSQQGYFSCSRGVRQGDPLSPLLFCLA 333 Query: 71 EDVLSRIFLDAVNRGLITGMR 9 EDVLSR V +G + MR Sbjct: 334 EDVLSRSLTKLVEQGKLKQMR 354 >gb|ABD28670.2| RNA-directed DNA polymerase (Reverse transcriptase) [Medicago truncatula] Length = 642 Score = 100 bits (249), Expect = 1e-19 Identities = 46/78 (58%), Positives = 59/78 (75%) Frame = -3 Query: 254 DFLLFVLQQFGFPNIFCSWIKTILSSARISIRFNGALYGYFECGRGVRQGDPLSPILFAL 75 DFLL VL+ FGF +FC+WIKTIL S+++ I NGA +G+F C RGVRQGDPLSP+LF + Sbjct: 334 DFLLLVLKTFGFNELFCNWIKTILHSSKMFISMNGAQHGFFNCNRGVRQGDPLSPLLFCI 393 Query: 74 AEDVLSRIFLDAVNRGLI 21 E+VLSR ++GLI Sbjct: 394 VEEVLSRSISILADKGLI 411 >gb|ABE87589.2| RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease H; Endonuclease/exonuclease/phosphatase [Medicago truncatula] Length = 1246 Score = 88.2 bits (217), Expect = 6e-16 Identities = 44/83 (53%), Positives = 53/83 (63%) Frame = -3 Query: 254 DFLLFVLQQFGFPNIFCSWIKTILSSARISIRFNGALYGYFECGRGVRQGDPLSPILFAL 75 +FLL VLQ+FGF F WI IL SAR+S+ NG G+F C GVRQGDPLSP+LF L Sbjct: 599 NFLLAVLQRFGFDEKFVHWILVILQSARLSVLVNGKAVGFFTCSHGVRQGDPLSPLLFCL 658 Query: 74 AEDVLSRIFLDAVNRGLITGMRF 6 E+VLSR A G + M + Sbjct: 659 VEEVLSRALSMAATDGQLIPMSY 681 >emb|CAN60702.1| hypothetical protein VITISV_015869 [Vitis vinifera] Length = 3028 Score = 80.9 bits (198), Expect = 1e-13 Identities = 39/82 (47%), Positives = 50/82 (60%) Frame = -3 Query: 254 DFLLFVLQQFGFPNIFCSWIKTILSSARISIRFNGALYGYFECGRGVRQGDPLSPILFAL 75 DFL+FVLQ GF + WI +S+A S+ NG GYF RG+RQGDPLSP LF + Sbjct: 2451 DFLIFVLQSMGFGEKWIGWISWCISTATFSVLINGTPEGYFNSSRGLRQGDPLSPYLFVI 2510 Query: 74 AEDVLSRIFLDAVNRGLITGMR 9 + LSR+ AV G ++G R Sbjct: 2511 GMEALSRLINRAVGGGFLSGCR 2532 >emb|CAN74986.1| hypothetical protein VITISV_008771 [Vitis vinifera] Length = 1971 Score = 80.5 bits (197), Expect = 1e-13 Identities = 40/82 (48%), Positives = 50/82 (60%) Frame = -3 Query: 254 DFLLFVLQQFGFPNIFCSWIKTILSSARISIRFNGALYGYFECGRGVRQGDPLSPILFAL 75 +FLLFVLQ GF + WI +S+A S+ NG GYF RG+RQGDPLSP LF L Sbjct: 897 NFLLFVLQSMGFGEKWIGWISWCISTATFSVLINGTPEGYFNSSRGLRQGDPLSPYLFVL 956 Query: 74 AEDVLSRIFLDAVNRGLITGMR 9 + LSR+ AV G ++G R Sbjct: 957 GMEALSRLIHRAVGGGFLSGCR 978