BLASTX nr result
ID: Salvia21_contig00034788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00034788 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_568465.1| endomembrane family protein 70 [Arabidopsis tha... 60 2e-07 ref|XP_002515423.1| Endosomal P24A protein precursor, putative [... 59 5e-07 >ref|NP_568465.1| endomembrane family protein 70 [Arabidopsis thaliana] gi|13430446|gb|AAK25845.1|AF360135_1 putative multispanning membrane protein [Arabidopsis thaliana] gi|332006016|gb|AED93399.1| endomembrane family protein 70 [Arabidopsis thaliana] Length = 644 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/48 (64%), Positives = 34/48 (70%) Frame = +1 Query: 112 RRSHAIQMCMYITLFLVATVAHSFYLPGVAPMDFLKGDLLKVKVNKLT 255 R S +Q+ + L L VAHSFYLPGVAP DF KGD LKVKVNKLT Sbjct: 5 RSSRRLQILGSVILLLSIHVAHSFYLPGVAPQDFEKGDELKVKVNKLT 52 >ref|XP_002515423.1| Endosomal P24A protein precursor, putative [Ricinus communis] gi|223545367|gb|EEF46872.1| Endosomal P24A protein precursor, putative [Ricinus communis] Length = 645 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = +1 Query: 97 MEVIGRRSHAIQMCMYITLFLVATVAHSFYLPGVAPMDFLKGDLLKVKVNKLT 255 ME GR ++C ++ + AH FYLPGVAP DF+KGD LKVKVNKLT Sbjct: 3 MEPRGRGRSLSKICTVLSFLFLIHSAHCFYLPGVAPEDFVKGDELKVKVNKLT 55