BLASTX nr result
ID: Salvia21_contig00034772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00034772 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271198.2| PREDICTED: uncharacterized protein LOC100251... 57 1e-14 >ref|XP_002271198.2| PREDICTED: uncharacterized protein LOC100251719 [Vitis vinifera] gi|297739209|emb|CBI28860.3| unnamed protein product [Vitis vinifera] Length = 683 Score = 56.6 bits (135), Expect(2) = 1e-14 Identities = 22/32 (68%), Positives = 29/32 (90%) Frame = +3 Query: 186 DSGKFYILVDNRPWLKDLVSRPMDLWQLMVTK 281 +S KFY+LVDN+PWL+++VSRP +WQLMVTK Sbjct: 35 ESNKFYVLVDNQPWLREIVSRPAHIWQLMVTK 66 Score = 47.4 bits (111), Expect(2) = 1e-14 Identities = 27/47 (57%), Positives = 31/47 (65%) Frame = +2 Query: 257 FVAIDGH*VTLS*KRAWLPVKKLRNSHISNSKLHRTLYGLIVCEVAY 397 F ID TLS KR LPVK +S + NS+LHRTLYG IV EVA+ Sbjct: 107 FTLIDA--ATLSRKRVLLPVKNFSSSLLLNSELHRTLYGFIVFEVAW 151