BLASTX nr result
ID: Salvia21_contig00034335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00034335 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323282.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 gb|AFK41333.1| unknown [Lotus japonicus] 62 5e-08 ref|XP_004136735.1| PREDICTED: uncharacterized protein LOC101203... 62 6e-08 ref|XP_002876449.1| VQ motif-containing protein [Arabidopsis lyr... 61 1e-07 ref|XP_002530705.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 >ref|XP_002323282.1| predicted protein [Populus trichocarpa] gi|222867912|gb|EEF05043.1| predicted protein [Populus trichocarpa] Length = 125 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 101 IRIIHIFAPEIIKTDAANFRELVQRLTGKP 12 IRIIHIFAPEIIKTDAANFRELVQRLTGKP Sbjct: 15 IRIIHIFAPEIIKTDAANFRELVQRLTGKP 44 >gb|AFK41333.1| unknown [Lotus japonicus] Length = 144 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 101 IRIIHIFAPEIIKTDAANFRELVQRLTGKPD 9 IRIIHI+APEIIKTDAANFRELVQRLTGKP+ Sbjct: 32 IRIIHIYAPEIIKTDAANFRELVQRLTGKPE 62 >ref|XP_004136735.1| PREDICTED: uncharacterized protein LOC101203704 [Cucumis sativus] Length = 166 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 101 IRIIHIFAPEIIKTDAANFRELVQRLTGKPD 9 IRIIHIFAPEIIKTD ANFRELVQRLTGKP+ Sbjct: 41 IRIIHIFAPEIIKTDVANFRELVQRLTGKPE 71 >ref|XP_002876449.1| VQ motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297322287|gb|EFH52708.1| VQ motif-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 175 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/31 (93%), Positives = 29/31 (93%) Frame = -2 Query: 101 IRIIHIFAPEIIKTDAANFRELVQRLTGKPD 9 IRIIHIFAPEIIKTD ANFRELVQ LTGKPD Sbjct: 32 IRIIHIFAPEIIKTDVANFRELVQSLTGKPD 62 >ref|XP_002530705.1| conserved hypothetical protein [Ricinus communis] gi|223529719|gb|EEF31659.1| conserved hypothetical protein [Ricinus communis] Length = 181 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 101 IRIIHIFAPEIIKTDAANFRELVQRLTGKP 12 IRIIHIFAPEIIKTD ANFRELVQRLTGKP Sbjct: 46 IRIIHIFAPEIIKTDVANFRELVQRLTGKP 75