BLASTX nr result
ID: Salvia21_contig00034032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00034032 (335 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003546766.1| PREDICTED: interactor of constitutive active... 82 6e-14 ref|XP_003543151.1| PREDICTED: interactor of constitutive active... 79 4e-13 emb|CBI32925.3| unnamed protein product [Vitis vinifera] 74 9e-12 ref|XP_002300426.1| predicted protein [Populus trichocarpa] gi|2... 72 6e-11 ref|XP_002530129.1| conserved hypothetical protein [Ricinus comm... 70 1e-10 >ref|XP_003546766.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform 1 [Glycine max] gi|356556918|ref|XP_003546767.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform 2 [Glycine max] Length = 380 Score = 81.6 bits (200), Expect = 6e-14 Identities = 47/76 (61%), Positives = 53/76 (69%), Gaps = 3/76 (3%) Frame = +1 Query: 115 MPRSRASELPQRPSPRAPHSLRTXXXXXXXPVHQRSRTTERSPRLSDGRSP---QSEPLN 285 MPRSR SELPQR SPR PH RT P+H R +RSP+L D RSP QSE LN Sbjct: 1 MPRSRGSELPQRQSPRGPHQHRT-SSSDSDPLHHR-LIADRSPKLGDRRSPRGTQSEGLN 58 Query: 286 QRKLGSRIADLETQLG 333 Q+KLG+RIADLE+QLG Sbjct: 59 QKKLGTRIADLESQLG 74 >ref|XP_003543151.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform 1 [Glycine max] gi|356549542|ref|XP_003543152.1| PREDICTED: interactor of constitutive active ROPs 1-like isoform 2 [Glycine max] Length = 377 Score = 79.0 bits (193), Expect = 4e-13 Identities = 46/76 (60%), Positives = 52/76 (68%), Gaps = 3/76 (3%) Frame = +1 Query: 115 MPRSRASELPQRPSPRAPHSLRTXXXXXXXPVHQRSRTTERSPRLSDGRSP---QSEPLN 285 MPRSR SELPQR SPR H RT P+H R +RSP+L D RSP QSE LN Sbjct: 1 MPRSRGSELPQRQSPRGAHQHRTSSSDSD-PLHHRP-IADRSPKLGDRRSPRGTQSEGLN 58 Query: 286 QRKLGSRIADLETQLG 333 Q+KLG+RIADLE+QLG Sbjct: 59 QKKLGTRIADLESQLG 74 >emb|CBI32925.3| unnamed protein product [Vitis vinifera] Length = 362 Score = 74.3 bits (181), Expect = 9e-12 Identities = 42/76 (55%), Positives = 53/76 (69%), Gaps = 3/76 (3%) Frame = +1 Query: 115 MPRSRASELPQRPSPRAPHSLRTXXXXXXXPVHQRSRTTERSPRLSDGRSP---QSEPLN 285 MPR+R SE+PQR SPR LRT P+H R T+RSP++ D RSP QS+ +N Sbjct: 1 MPRTRGSEMPQRQSPRGSLQLRTSSSDSD-PLHHRP-ITDRSPKVGDRRSPRGAQSDSVN 58 Query: 286 QRKLGSRIADLETQLG 333 Q+KLG+RIADLE+QLG Sbjct: 59 QKKLGTRIADLESQLG 74 >ref|XP_002300426.1| predicted protein [Populus trichocarpa] gi|222847684|gb|EEE85231.1| predicted protein [Populus trichocarpa] Length = 341 Score = 71.6 bits (174), Expect = 6e-11 Identities = 42/76 (55%), Positives = 50/76 (65%), Gaps = 3/76 (3%) Frame = +1 Query: 115 MPRSRASELPQRPSPRAPHSLRTXXXXXXXPVHQRSRTTERSPRLSDGRSP---QSEPLN 285 MPRSR SE+PQR SPR H LRT P+H R T+R +L D SP Q + LN Sbjct: 1 MPRSRGSEMPQRQSPRGSHPLRT-SNSDSDPLHHRP-ITDRREKLGDRCSPRGSQPDSLN 58 Query: 286 QRKLGSRIADLETQLG 333 Q+KLG+RIADLE+QLG Sbjct: 59 QKKLGTRIADLESQLG 74 >ref|XP_002530129.1| conserved hypothetical protein [Ricinus communis] gi|223530354|gb|EEF32245.1| conserved hypothetical protein [Ricinus communis] Length = 383 Score = 70.5 bits (171), Expect = 1e-10 Identities = 42/76 (55%), Positives = 51/76 (67%), Gaps = 3/76 (3%) Frame = +1 Query: 115 MPRSRASELPQRPSPRAPHSLRTXXXXXXXPVHQRSRTTERSPRLSDGRSPQS---EPLN 285 MPRSR SE+PQR R H LRT P+H RS T+RS +L D RSP+ + LN Sbjct: 1 MPRSRGSEMPQRLVSRGSHPLRTSSSDSD-PLHHRS-ITDRSLKLGDRRSPRGSHPDSLN 58 Query: 286 QRKLGSRIADLETQLG 333 Q+KLG+RIADLE+QLG Sbjct: 59 QKKLGTRIADLESQLG 74