BLASTX nr result
ID: Salvia21_contig00033429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00033429 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003611653.1| Indole-3-acetic acid-amido synthetase GH3.3 ... 110 1e-22 ref|XP_002885948.1| GH3.1 [Arabidopsis lyrata subsp. lyrata] gi|... 110 1e-22 ref|NP_179101.1| putative indole-3-acetic acid-amido synthetase ... 110 1e-22 ref|NP_001060163.1| Os07g0592600 [Oryza sativa Japonica Group] g... 109 3e-22 gb|AAS02074.1| auxin and ethylene responsive GH3-like protein [C... 109 3e-22 >ref|XP_003611653.1| Indole-3-acetic acid-amido synthetase GH3.3 [Medicago truncatula] gi|355512988|gb|AES94611.1| Indole-3-acetic acid-amido synthetase GH3.3 [Medicago truncatula] Length = 600 Score = 110 bits (275), Expect = 1e-22 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = +2 Query: 2 RVVRSGTFEELMDFAISKGASINQYKVPRCVTFAPIVELLDSRIVSTHFSPSLPRWTSQR 181 RVV++GTFEELMD+AIS+GASINQYKVPRCV+F PI+ELLDSR+VS HFSPSLP WTS+R Sbjct: 539 RVVKNGTFEELMDYAISRGASINQYKVPRCVSFTPIMELLDSRVVSVHFSPSLPHWTSER 598 Query: 182 R 184 R Sbjct: 599 R 599 >ref|XP_002885948.1| GH3.1 [Arabidopsis lyrata subsp. lyrata] gi|297331788|gb|EFH62207.1| GH3.1 [Arabidopsis lyrata subsp. lyrata] Length = 590 Score = 110 bits (275), Expect = 1e-22 Identities = 51/61 (83%), Positives = 56/61 (91%) Frame = +2 Query: 2 RVVRSGTFEELMDFAISKGASINQYKVPRCVTFAPIVELLDSRIVSTHFSPSLPRWTSQR 181 RVVR+GTFEELMD+AIS+GASINQYKVPRCV F PIVELLDSR+VS HFSPSLP WT +R Sbjct: 528 RVVRNGTFEELMDYAISRGASINQYKVPRCVNFTPIVELLDSRVVSAHFSPSLPHWTPER 587 Query: 182 R 184 R Sbjct: 588 R 588 >ref|NP_179101.1| putative indole-3-acetic acid-amido synthetase GH3.1 [Arabidopsis thaliana] gi|62900130|sp|O82333.1|GH31_ARATH RecName: Full=Probable indole-3-acetic acid-amido synthetase GH3.1; AltName: Full=Auxin-responsive GH3-like protein 1; Short=AtGH3-1 gi|3650037|gb|AAC61292.1| putative auxin-regulated protein [Arabidopsis thaliana] gi|330251259|gb|AEC06353.1| putative indole-3-acetic acid-amido synthetase GH3.1 [Arabidopsis thaliana] Length = 590 Score = 110 bits (275), Expect = 1e-22 Identities = 51/61 (83%), Positives = 56/61 (91%) Frame = +2 Query: 2 RVVRSGTFEELMDFAISKGASINQYKVPRCVTFAPIVELLDSRIVSTHFSPSLPRWTSQR 181 RVVR+GTFEELMD+AIS+GASINQYKVPRCV F PIVELLDSR+VS HFSPSLP WT +R Sbjct: 528 RVVRNGTFEELMDYAISRGASINQYKVPRCVNFTPIVELLDSRVVSAHFSPSLPHWTPER 587 Query: 182 R 184 R Sbjct: 588 R 588 >ref|NP_001060163.1| Os07g0592600 [Oryza sativa Japonica Group] gi|122167127|sp|Q0D4Z6.1|GH38_ORYSJ RecName: Full=Probable indole-3-acetic acid-amido synthetase GH3.8; AltName: Full=Auxin-responsive GH3-like protein 8; Short=OsGH3-8 gi|158513704|sp|A3BLS0.2|GH38_ORYSI RecName: Full=Probable indole-3-acetic acid-amido synthetase GH3.8; AltName: Full=Auxin-responsive GH3-like protein 8; Short=OsGH3-8 gi|33146510|dbj|BAC79627.1| putative Nt-gh3 deduced protein [Oryza sativa Japonica Group] gi|113611699|dbj|BAF22077.1| Os07g0592600 [Oryza sativa Japonica Group] gi|124518471|gb|ABN13880.1| auxin-responsive GH3-8 protein [Oryza sativa Indica Group] gi|218199947|gb|EEC82374.1| hypothetical protein OsI_26708 [Oryza sativa Indica Group] gi|222637381|gb|EEE67513.1| hypothetical protein OsJ_24963 [Oryza sativa Japonica Group] Length = 605 Score = 109 bits (272), Expect = 3e-22 Identities = 51/61 (83%), Positives = 56/61 (91%) Frame = +2 Query: 2 RVVRSGTFEELMDFAISKGASINQYKVPRCVTFAPIVELLDSRIVSTHFSPSLPRWTSQR 181 RVVR GTFEELMD+AIS+GASINQYKVPRCVTF PIVELLDSR+VS+HFSP+LP WT R Sbjct: 543 RVVRPGTFEELMDYAISRGASINQYKVPRCVTFPPIVELLDSRVVSSHFSPALPHWTPAR 602 Query: 182 R 184 R Sbjct: 603 R 603 >gb|AAS02074.1| auxin and ethylene responsive GH3-like protein [Capsicum chinense] Length = 595 Score = 109 bits (272), Expect = 3e-22 Identities = 49/61 (80%), Positives = 59/61 (96%) Frame = +2 Query: 2 RVVRSGTFEELMDFAISKGASINQYKVPRCVTFAPIVELLDSRIVSTHFSPSLPRWTSQR 181 RVV++GTFEELMD+AIS+GASINQYKVPRCV FAPI+ELLDSR++S+HFSPSLP+WT +R Sbjct: 534 RVVKNGTFEELMDYAISRGASINQYKVPRCVNFAPILELLDSRVMSSHFSPSLPQWTPER 593 Query: 182 R 184 R Sbjct: 594 R 594