BLASTX nr result
ID: Salvia21_contig00033334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00033334 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003603448.1| Organ-specific protein S2 [Medicago truncatu... 65 6e-09 emb|CAN67243.1| hypothetical protein VITISV_017120 [Vitis vinifera] 62 4e-08 ref|XP_003631638.1| PREDICTED: organ-specific protein S2-like [V... 62 6e-08 emb|CBI32573.3| unnamed protein product [Vitis vinifera] 59 5e-07 ref|XP_003631642.1| PREDICTED: organ-specific protein S2-like [V... 59 5e-07 >ref|XP_003603448.1| Organ-specific protein S2 [Medicago truncatula] gi|355492496|gb|AES73699.1| Organ-specific protein S2 [Medicago truncatula] Length = 478 Score = 65.1 bits (157), Expect = 6e-09 Identities = 35/75 (46%), Positives = 40/75 (53%) Frame = +1 Query: 4 DFEPRPNFFLYNHDNSNVDHGHKPTGEKSFVKDFEPRSDFFPYDKYANLNVDGHKPTGEK 183 DFEPRPNFFLY + N K KDF PR +FF Y K +G K Sbjct: 236 DFEPRPNFFLYGENGVNAKEN------KGATKDFNPRPNFFLYGK------NGVDAKENK 283 Query: 184 SFVKDFEPRSDFFLY 228 F+KDFEPR +FFLY Sbjct: 284 GFIKDFEPRPNFFLY 298 Score = 64.3 bits (155), Expect = 1e-08 Identities = 37/76 (48%), Positives = 42/76 (55%) Frame = +1 Query: 1 KDFEPRPNFFLYNHDNSNVDHGHKPTGEKSFVKDFEPRSDFFPYDKYANLNVDGHKPTGE 180 KDF PRPNFFLY +G K F+KDFEPR +FF YA VD + Sbjct: 261 KDFNPRPNFFLYG------KNGVDAKENKGFIKDFEPRPNFF---LYAENGVDAEE---N 308 Query: 181 KSFVKDFEPRSDFFLY 228 K KDFEPR +FFLY Sbjct: 309 KEATKDFEPRPNFFLY 324 Score = 59.3 bits (142), Expect = 3e-07 Identities = 36/76 (47%), Positives = 41/76 (53%) Frame = +1 Query: 1 KDFEPRPNFFLYNHDNSNVDHGHKPTGEKSFVKDFEPRSDFFPYDKYANLNVDGHKPTGE 180 KDFEPRPNFFLY ++G K KDFEPR +FF Y VDG + Sbjct: 131 KDFEPRPNFFLYG------ENGVDAKENKRSGKDFEPRPNFF---LYGENGVDGEE---N 178 Query: 181 KSFVKDFEPRSDFFLY 228 K KDFE R +FFLY Sbjct: 179 KEATKDFESRPNFFLY 194 Score = 58.9 bits (141), Expect = 4e-07 Identities = 35/76 (46%), Positives = 41/76 (53%) Frame = +1 Query: 1 KDFEPRPNFFLYNHDNSNVDHGHKPTGEKSFVKDFEPRSDFFPYDKYANLNVDGHKPTGE 180 KDFEPRPNFFLY ++G K KDFEPR +FF Y VD + Sbjct: 287 KDFEPRPNFFLY------AENGVDAEENKEATKDFEPRPNFF---LYGGKRVDTKE---N 334 Query: 181 KSFVKDFEPRSDFFLY 228 K +KDFE R +FFLY Sbjct: 335 KGSIKDFESRPNFFLY 350 Score = 57.8 bits (138), Expect = 9e-07 Identities = 34/79 (43%), Positives = 42/79 (53%) Frame = +1 Query: 1 KDFEPRPNFFLYNHDNSNVDHGHKPTGEKSFVKDFEPRSDFFPYDKYANLNVDGHKPTGE 180 KDF+PRPNFFLY ++G K KDFEPR +FF Y + +G Sbjct: 105 KDFKPRPNFFLYG------ENGVDAKENKRSGKDFEPRPNFFLYGE------NGVDAKEN 152 Query: 181 KSFVKDFEPRSDFFLYNHD 237 K KDFEPR +FFLY + Sbjct: 153 KRSGKDFEPRPNFFLYGEN 171 Score = 57.4 bits (137), Expect = 1e-06 Identities = 33/79 (41%), Positives = 39/79 (49%) Frame = +1 Query: 1 KDFEPRPNFFLYNHDNSNVDHGHKPTGEKSFVKDFEPRSDFFPYDKYANLNVDGHKPTGE 180 KDFEPRPNFFLY + K +KDFE R +FF Y + G Sbjct: 313 KDFEPRPNFFLYGGKRVDTKEN------KGSIKDFESRPNFFLYGE------KGVDTKEN 360 Query: 181 KSFVKDFEPRSDFFLYNHD 237 K KDFEPR +FFLY + Sbjct: 361 KGTAKDFEPRPNFFLYGEN 379 Score = 56.6 bits (135), Expect = 2e-06 Identities = 34/79 (43%), Positives = 41/79 (51%) Frame = +1 Query: 1 KDFEPRPNFFLYNHDNSNVDHGHKPTGEKSFVKDFEPRSDFFPYDKYANLNVDGHKPTGE 180 KDFEPRPNFFLY D+ K KDF+PR +FF Y + +G Sbjct: 79 KDFEPRPNFFLYG------DNAIDAKENKVANKDFKPRPNFFLYGE------NGVDAKEN 126 Query: 181 KSFVKDFEPRSDFFLYNHD 237 K KDFEPR +FFLY + Sbjct: 127 KRSGKDFEPRPNFFLYGEN 145 Score = 56.2 bits (134), Expect = 3e-06 Identities = 34/76 (44%), Positives = 40/76 (52%) Frame = +1 Query: 1 KDFEPRPNFFLYNHDNSNVDHGHKPTGEKSFVKDFEPRSDFFPYDKYANLNVDGHKPTGE 180 KDFEPRPNFFLY ++G K KDFE R +FF Y K +N ++ Sbjct: 157 KDFEPRPNFFLYG------ENGVDGEENKEATKDFESRPNFFLYGK-KEVNTKENRGVN- 208 Query: 181 KSFVKDFEPRSDFFLY 228 KDFEPR FFLY Sbjct: 209 ----KDFEPRPSFFLY 220 Score = 55.8 bits (133), Expect = 3e-06 Identities = 34/79 (43%), Positives = 37/79 (46%) Frame = +1 Query: 1 KDFEPRPNFFLYNHDNSNVDHGHKPTGEKSFVKDFEPRSDFFPYDKYANLNVDGHKPTGE 180 KDFE RPNFFLY N + KDFEPR FF Y VD K Sbjct: 183 KDFESRPNFFLYGKKEVNTKEN------RGVNKDFEPRPSFF---LYGEKRVDTEK---N 230 Query: 181 KSFVKDFEPRSDFFLYNHD 237 K DFEPR +FFLY + Sbjct: 231 KGATNDFEPRPNFFLYGEN 249 >emb|CAN67243.1| hypothetical protein VITISV_017120 [Vitis vinifera] Length = 146 Score = 62.4 bits (150), Expect = 4e-08 Identities = 37/78 (47%), Positives = 44/78 (56%) Frame = +1 Query: 1 KDFEPRPNFFLYNHDNSNVDHGHKPTGEKSFVKDFEPRSDFFPYDKYANLNVDGHKPTGE 180 +DFEPRPN +Y HD+S V EKSFVKDFEP + Y D G+ Sbjct: 82 EDFEPRPNVSVY-HDDSKVGE------EKSFVKDFEPGPNLSVYHD------DEVASKGD 128 Query: 181 KSFVKDFEPRSDFFLYNH 234 KSFV DFEPR + +YNH Sbjct: 129 KSFVNDFEPRPNLSVYNH 146 >ref|XP_003631638.1| PREDICTED: organ-specific protein S2-like [Vitis vinifera] Length = 146 Score = 61.6 bits (148), Expect = 6e-08 Identities = 37/78 (47%), Positives = 43/78 (55%) Frame = +1 Query: 1 KDFEPRPNFFLYNHDNSNVDHGHKPTGEKSFVKDFEPRSDFFPYDKYANLNVDGHKPTGE 180 +DFEPRPN Y HD+S V EKSFVKDFEP + Y D G+ Sbjct: 82 EDFEPRPNVSAY-HDDSKVGE------EKSFVKDFEPGPNLSVYHD------DEVASKGD 128 Query: 181 KSFVKDFEPRSDFFLYNH 234 KSFV DFEPR + +YNH Sbjct: 129 KSFVNDFEPRPNLSVYNH 146 >emb|CBI32573.3| unnamed protein product [Vitis vinifera] Length = 180 Score = 58.5 bits (140), Expect = 5e-07 Identities = 36/77 (46%), Positives = 43/77 (55%) Frame = +1 Query: 1 KDFEPRPNFFLYNHDNSNVDHGHKPTGEKSFVKDFEPRSDFFPYDKYANLNVDGHKPTGE 180 +DFEPRPN +Y HD+S V EKSFVKDFEP + Y D G+ Sbjct: 116 EDFEPRPNVSVY-HDDSKVGE------EKSFVKDFEPGPNVSVYHD------DEVASKGD 162 Query: 181 KSFVKDFEPRSDFFLYN 231 KSFV DFEPR + +YN Sbjct: 163 KSFVNDFEPRPNVSVYN 179 >ref|XP_003631642.1| PREDICTED: organ-specific protein S2-like [Vitis vinifera] Length = 146 Score = 58.5 bits (140), Expect = 5e-07 Identities = 36/77 (46%), Positives = 43/77 (55%) Frame = +1 Query: 1 KDFEPRPNFFLYNHDNSNVDHGHKPTGEKSFVKDFEPRSDFFPYDKYANLNVDGHKPTGE 180 +DFEPRPN +Y HD+S V EKSFVKDFEP + Y D G+ Sbjct: 82 EDFEPRPNVSVY-HDDSKVGE------EKSFVKDFEPGPNVSVYHD------DEVASKGD 128 Query: 181 KSFVKDFEPRSDFFLYN 231 KSFV DFEPR + +YN Sbjct: 129 KSFVNDFEPRPNVSVYN 145