BLASTX nr result
ID: Salvia21_contig00033115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Salvia21_contig00033115 (506 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531330.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002531330.1| conserved hypothetical protein [Ricinus communis] gi|223529069|gb|EEF31053.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 56.2 bits (134), Expect = 3e-06 Identities = 22/45 (48%), Positives = 31/45 (68%) Frame = -2 Query: 385 RRFYYCSKREWNDCGLWQWADPELSSYYKLCFNNIKNERDKLVEQ 251 RRFY C R+++DC +QW DPEL ++K CF K +++KL EQ Sbjct: 16 RRFYQCYVRKYDDCNFFQWCDPELPPFHKACFVKFKVQKEKLEEQ 60